close all open/close all
Enter_00190 Enter_00190   last last

CDS information : Enter_00200


close this sectionLocation

Organism
Strain
Entry nameEnterocin
Contig
Start / Stop / Direction20,407 / 21,855 / + [in whole cluster]
20,407 / 21,855 / + [in contig]
Location20407..21855 [in whole cluster]
20407..21855 [in contig]
TypeCDS
Length1,449 bp (482 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)putative efflux protein EncT
Gene
Gene (GenBank)encT
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
Related Reference
ACC
Q9WVV3
PmId
[10198016] Mitomycin resistance in Streptomyces lavendulae includes a novel drug-binding-protein-dependent export system. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative drug resistance transporter [putative efflux protein EncT]
MGQREARAADGSVDTEKETGALVPRQAALLWLACAAQFMVVLDVSVVNVALPSIQTALGF
DAAGLQWVVGSYALVFAGFLLLGGRLADLYGRRRAFVWGLALFSVSSLVGGLATGPGLLI
AMRAVQGLGAAVLAPATLTILTTTFPEGPGRTKALAIWTAVSSAGGAAGNLIGGVLTDAL
SWRWILLINVPIGTVAVLAALRLLPSDRSRAVSGRLDVPGAVLATLGVTALVYGVNQAGT
QGWTGATTLTGLAVSAVALTAFAVTESRYTAAPLLPPRLVRLRPIWAGNVTMLLAGGCFI
PMWYFLSLYMQEVLHYGALAAGVGFLPHTLVGIAAARLAPAVMERTGARGLIVLSAVLSA
VGFVWQSSISTDSGYLDGLLGPAIVMSAGMGLLITPITTTVTSGIREQDAGAASGLMNTT
RQLGGVVGLSALVTLATADGGPDLSYRAVFVATAAVCAGVAVMALALPAPQEGRDESVAM
QR
selected fasta
>putative drug resistance transporter [putative efflux protein EncT]
ATGGGACAACGCGAAGCCCGTGCCGCCGACGGATCAGTCGACACCGAGAAAGAAACAGGC
GCACTGGTGCCCCGTCAGGCGGCGCTGTTATGGCTGGCCTGCGCGGCACAGTTCATGGTG
GTGCTCGACGTGTCGGTGGTGAACGTCGCGCTGCCGTCGATCCAGACCGCGCTCGGCTTC
GACGCGGCGGGACTGCAGTGGGTCGTGGGCAGCTACGCGCTGGTCTTCGCGGGTTTCCTG
CTTCTCGGCGGTCGGCTCGCGGACCTGTACGGCCGACGTCGGGCGTTCGTGTGGGGGCTG
GCGCTGTTCTCCGTCTCCAGCCTGGTGGGCGGACTCGCCACCGGCCCCGGCCTGCTGATC
GCCATGCGGGCGGTGCAGGGCCTGGGCGCCGCGGTGCTGGCCCCGGCCACGCTGACCATC
CTGACCACCACCTTCCCCGAAGGGCCGGGCCGCACCAAGGCGTTGGCGATCTGGACTGCA
GTCAGCTCCGCCGGAGGCGCGGCGGGCAACCTGATCGGCGGCGTCCTGACCGACGCACTG
TCCTGGCGGTGGATCCTGCTGATCAACGTGCCGATCGGCACCGTGGCCGTCCTGGCGGCC
CTGCGTCTGCTGCCGTCCGACCGCTCCCGCGCGGTATCCGGCAGGCTCGACGTCCCCGGG
GCGGTGCTGGCCACCCTCGGCGTCACCGCACTCGTCTACGGCGTCAACCAGGCCGGGACA
CAGGGCTGGACAGGGGCGACCACCCTGACGGGCCTGGCGGTCAGCGCCGTGGCGCTGACC
GCGTTCGCGGTGACGGAGAGCCGGTACACGGCGGCCCCCCTATTGCCGCCCCGCCTGGTG
CGGCTGCGCCCGATCTGGGCCGGCAACGTCACCATGCTGCTGGCGGGCGGCTGCTTCATC
CCTATGTGGTACTTCCTGTCGCTGTACATGCAGGAGGTCCTCCACTACGGGGCCTTGGCC
GCGGGCGTCGGTTTCCTGCCCCACACGCTTGTCGGTATCGCGGCTGCCCGCCTCGCCCCG
GCCGTCATGGAGCGCACCGGCGCCCGCGGCCTCATCGTTCTCAGCGCCGTCCTCAGCGCC
GTCGGCTTTGTCTGGCAGAGCAGCATCAGCACGGACAGCGGCTACCTGGACGGACTGCTC
GGGCCCGCGATCGTCATGTCCGCCGGCATGGGACTGCTCATCACCCCGATCACTACCACC
GTCACCTCCGGCATCCGCGAGCAGGATGCGGGGGCAGCCTCCGGGCTGATGAACACCACC
CGCCAGCTCGGCGGTGTCGTCGGGCTCTCTGCCCTCGTCACCCTCGCTACCGCCGACGGC
GGTCCGGACCTGTCGTACAGGGCGGTGTTCGTGGCGACGGCGGCTGTGTGCGCGGGCGTT
GCGGTGATGGCCTTGGCGCTGCCTGCGCCACAAGAGGGCCGGGACGAGTCCGTCGCGATG
CAGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [34-437]  2.90000000000003e-75 TIGR00711
TIGR00711   Efflux_EmrB
IPR005829 Sugar transporter, conserved site (Conserved_site)
 [83-99]  PS00216
PS00216   SUGAR_TRANSPORT_1
IPR011701 Major facilitator superfamily (Family)
 [34-428]  8.30000000000004e-49 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-475]  2.59998233910302e-73 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [29-472]  PS50850
PS50850   MFS
SignalP
 [1-8]  0.211 Signal
Bacteria, Gram-negative   
TMHMM
 [28-47]  Transmembrane (i-o) [62-84]  Transmembrane (o-i) [96-115]  Transmembrane (i-o) [120-142]  Transmembrane (o-i) [155-177]  Transmembrane (i-o) [182-204]  Transmembrane (o-i) [211-233]  Transmembrane (i-o) [243-265]  Transmembrane (o-i) [286-308]  Transmembrane (i-o) [313-335]  Transmembrane (o-i) [347-369]  Transmembrane (i-o) [379-401]  Transmembrane (o-i) [421-438]  Transmembrane (i-o) [448-470]  Transmembrane (o-i)
Transmembrane 14   
Enter_00190 Enter_00190   last last