close all open/close all
first first   Epoth_00020 Epoth_00020

CDS information : Epoth_00010


close this sectionLocation

Organism
StrainSo ce90
Entry nameEpothilone
Contig
Start / Stop / Direction3 / 1,826 / + [in whole cluster]
3 / 1,826 / + [in contig]
Location3..1826 [in whole cluster]
3..1826 [in contig]
TypeCDS
Length1,824 bp (607 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein(fragment)
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF1
Reference
ACC
PmId
[10662695] The biosynthetic gene cluster for the microtubule-stabilizing agents epothilones A and B from Sorangium cellulosum So ce90. (Chem Biol. , 2000)

close this sectionSequence

selected fasta
>hypothetical protein(fragment) [unknown]
ASLDALFARATSARVLDDGHGRATERHVLAEARGIEDLRALREHLRIQEGGPSFHCMCLG
DLTVELLAHDQPLASISFHHARSLRHPDWTSDAMLVDGPALVRWLAARGAPGPLREYEEE
RERARTAQEARRLWLAAAPPCFAPDLPRFEDDANGLPLGPMSPEVAEAERRLRASYATPE
LACAALLAWLGTGAGPWSGYPAYEMLPENLLLGFGLPTAIAAASAPGTSEAALRGAARLF
ASWEVVSSKKSQLGNIPEALWERLRTIVRAMGNADNLSRFERAEAIAAEVRRLRAQPAPF
AAGAGLAVAGVSSSGRLSGLVTDGDALYSGDGNDIVMFQPGRISPVVLLAGTDPFFELAP
PLSQMLFVAHANAGTISKVLTEGSPLIVMARNQARPMSLVHARGFMAWVNQAMVPDPERG
APFVVQRSTIMEFEHPTPRCLHEPAGSAFSLACDEEHLYWCELSAGRLELWRHPHHRPGA
PSRFAYLGEHPIAATWYPSLTLNATHVLWADPDRRAILGVDKRTGVEPIVLAETRHPPAH
VVSEDRDIFALTGQPDSRDWHVEHIRSGASTVVADYQRQLWDRPDMVLNRRGLFFTTNDR
ILTLARS
selected fasta
>hypothetical protein(fragment) [unknown]
GCTTCGCTCGACGCCCTCTTCGCCCGCGCCACCTCTGCCCGTGTGCTCGATGATGGCCAC
GGCCGGGCCACGGAGCGGCATGTGCTCGCCGAGGCGCGCGGGATCGAGGACCTCCGCGCC
CTCCGAGAGCACCTCCGCATCCAGGAAGGGGGGCCGTCCTTTCACTGCATGTGCCTCGGC
GACCTGACGGTGGAGCTCCTCGCGCACGACCAGCCCCTCGCGTCCATCAGCTTCCACCAT
GCCCGCAGCCTGAGGCACCCCGACTGGACCTCGGACGCGATGCTCGTCGACGGCCCCGCG
CTCGTCCGGTGGCTCGCCGCGCGCGGCGCGCCGGGTCCCCTCCGCGAGTACGAAGAGGAG
CGCGAGCGAGCCCGAACCGCGCAGGAGGCGAGGCGCCTGTGGCTCGCGGCCGCGCCGCCC
TGCTTCGCGCCCGATCTGCCCCGCTTCGAGGACGACGCCAACGGGCTGCCGCTCGGCCCG
ATGTCGCCTGAAGTCGCCGAGGCCGAGCGGCGCCTCCGCGCCTCGTACGCGACTCCTGAG
CTCGCCTGTGCCGCGCTGCTCGCCTGGCTCGGGACGGGCGCGGGTCCCTGGTCCGGATAT
CCCGCCTACGAGATGCTGCCAGAGAATCTGCTCCTCGGGTTTGGCCTCCCGACCGCGATC
GCCGCGGCCTCCGCGCCCGGCACATCGGAGGCCGCTCTCCGCGGCGCAGCGCGGCTGTTC
GCCTCCTGGGAGGTCGTATCGAGCAAGAAGAGCCAGCTCGGCAACATCCCCGAAGCCCTG
TGGGAGCGGCTCCGGACGATCGTCCGCGCGATGGGCAATGCCGACAACCTCTCTCGCTTC
GAGCGCGCCGAGGCGATCGCGGCGGAGGTGCGCCGCCTGCGCGCACAGCCGGCGCCCTTC
GCGGCGGGCGCCGGCCTGGCGGTCGCTGGGGTCTCCTCGAGCGGCCGGCTCTCGGGCCTC
GTGACCGACGGAGACGCATTGTACTCCGGCGACGGCAACGACATCGTCATGTTCCAACCC
GGCCGGATCTCGCCGGTCGTGCTGCTCGCCGGAACCGATCCCTTCTTCGAGCTCGCACCG
CCCCTCAGCCAGATGCTCTTCGTCGCGCACGCCAACGCGGGCACCATCTCCAAGGTCCTG
ACGGAAGGCAGCCCCCTCATCGTGATGGCAAGAAACCAGGCGCGACCGATGAGCCTCGTC
CACGCTCGCGGGTTCATGGCGTGGGTCAACCAGGCCATGGTGCCCGACCCCGAGCGGGGC
GCGCCCTTCGTCGTCCAGCGCTCGACCATCATGGAATTCGAGCACCCCACGCCTCGTTGT
CTCCACGAGCCCGCCGGCAGCGCTTTCTCCCTCGCCTGCGACGAGGAGCACCTCTACTGG
TGCGAGCTTTCGGCTGGCCGGCTCGAGCTATGGCGCCACCCGCACCACCGCCCCGGCGCC
CCGAGCCGCTTCGCGTACCTCGGCGAGCACCCCATTGCGGCGACCTGGTACCCCTCGCTC
ACCCTCAATGCGACCCACGTGCTGTGGGCCGACCCTGATCGCAGGGCCATCCTCGGGGTC
GACAAGCGCACCGGCGTAGAGCCCATCGTCCTCGCGGAGACGCGCCATCCCCCGGCGCAC
GTCGTGTCCGAGGACCGGGACATCTTCGCGCTTACCGGACAGCCCGACTCCCGCGACTGG
CACGTCGAGCACATCCGCTCCGGCGCCTCCACCGTCGTGGCCGACTACCAGCGCCAGCTA
TGGGACCGCCCTGACATGGTGCTCAATCGGCGCGGCCTCTTCTTCACGACGAACGACCGC
ATCCTGACGCTCGCCCGCAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011042 Six-bladed beta-propeller, TolB-like (Domain)
 [362-541]  0.00011 G3DSA:2.120.10.30
G3DSA:2.120.10.30   6-blade_b-propeller_TolB-like
SignalP No significant hit
TMHMM No significant hit
first first   Epoth_00020 Epoth_00020