close all open/close all

CDS information : Epoth_00020


close this sectionLocation

Organism
StrainSo ce90
Entry nameEpothilone
Contig
Start / Stop / Direction3,171 / 1,900 / - [in whole cluster]
3,171 / 1,900 / - [in contig]
Locationcomplement(1900..3171) [in whole cluster]
complement(1900..3171) [in contig]
TypeCDS
Length1,272 bp (423 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative hydrolase
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF2; similar to hypothetical proteins from Mycobacterium tuberculosis and Streptomyces coelicolor and to DD-peptidases
Reference
ACC
PmId
[10662695] The biosynthetic gene cluster for the microtubule-stabilizing agents epothilones A and B from Sorangium cellulosum So ce90. (Chem Biol. , 2000)
Related Reference
ACC
Q1I197
PmId
[16672512] Isolation and biochemical characterization of two novel metagenome-derived esterases. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>putative hydrolase [unknown]
MGALISVAAPGCALGGAEEEGQPGQDAGAGALAPAREVMAAEVAAGQMPGAVWLVARGDD
VHVDAVGVTELGGSAPMRRDTIFRIASMTKAVTATAVMMLVEEGKLDLDSPVDRWLPELA
NRKVLARIDGPIDETVPAERPITVRDLMTFTMGFGISFDASSPIQRAIDELGLVNAQPVP
MTPHGPDEWIRRLGTLPLMHQPGAQWMYNTGSLVQGVLVGRAADQGFDAFVRERILAPLG
MRDTDFHVPADKLARFAGCGYFTDEQTGEKTRMDRDGAESAYASPPAFPSGAAGLVSTVD
DYLLFARMLMNGGVHEGRRLLSAASVREMTADHLTPAQKAASSFFPGFFETHGWGYGMAV
VTAPDAVSEVPGRYGWDGGFGTSWINDPGRELIGIVMTQSAGFLFSGALERFWRSVYVAT
ESA
selected fasta
>putative hydrolase [unknown]
ATGGGAGCTTTGATCAGCGTGGCGGCGCCGGGGTGCGCGTTGGGTGGGGCCGAGGAGGAG
GGGCAGCCAGGGCAGGACGCGGGGGCCGGCGCGCTGGCGCCCGCGCGCGAGGTGATGGCG
GCGGAGGTGGCGGCGGGGCAGATGCCGGGAGCGGTCTGGCTGGTCGCGCGCGGCGACGAC
GTGCACGTGGACGCGGTGGGCGTGACCGAGCTCGGCGGCAGCGCGCCCATGCGGCGGGAC
ACGATCTTCCGGATCGCCTCGATGACGAAGGCGGTCACCGCGACGGCGGTGATGATGCTC
GTCGAGGAAGGCAAGCTCGACCTCGACTCCCCCGTCGACCGATGGTTGCCGGAGCTCGCG
AACCGGAAGGTGCTGGCGCGCATCGATGGTCCGATCGACGAGACGGTGCCCGCGGAGCGG
CCGATCACGGTGCGCGACCTGATGACGTTCACGATGGGCTTCGGAATCTCGTTCGACGCA
TCGTCGCCGATCCAGCGGGCCATCGACGAGCTCGGGCTCGTCAACGCGCAGCCGGTGCCG
ATGACGCCGCACGGGCCAGACGAGTGGATCCGGCGGCTCGGGACGCTGCCGCTCATGCAT
CAGCCGGGGGCGCAGTGGATGTACAACACGGGGAGCCTGGTGCAGGGGGTGCTCGTGGGG
CGCGCGGCCGACCAGGGCTTCGATGCGTTCGTGCGCGAGCGCATCCTCGCGCCGCTCGGG
ATGCGGGACACCGACTTTCACGTCCCGGCGGACAAGCTCGCTCGGTTCGCGGGCTGCGGT
TACTTCACCGACGAGCAGACGGGGGAGAAGACGCGCATGGATCGCGACGGGGCCGAGAGC
GCCTATGCCAGCCCGCCGGCGTTCCCTTCGGGCGCCGCCGGGCTCGTGTCGACGGTGGAC
GACTACCTCCTGTTCGCGCGCATGCTCATGAACGGCGGTGTGCACGAGGGCCGGCGGCTC
TTGAGCGCCGCCTCGGTGCGCGAGATGACGGCCGATCACCTCACGCCGGCCCAGAAGGCG
GCGTCCTCGTTTTTCCCGGGCTTCTTCGAGACGCACGGCTGGGGTTATGGGATGGCCGTG
GTCACGGCGCCGGACGCGGTCTCGGAGGTGCCCGGGCGCTATGGGTGGGACGGCGGGTTC
GGGACGTCCTGGATCAATGATCCGGGCCGCGAGCTGATCGGGATCGTGATGACACAATCC
GCCGGCTTCCTGTTCTCGGGGGCTCTCGAGCGTTTCTGGCGCAGCGTCTACGTCGCCACC
GAATCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001466 Beta-lactamase-related (Domain)
 [36-405]  2.09999999999996e-75 PF00144
PF00144   Beta-lactamase
IPR012338 Beta-lactamase/transpeptidase-like (Domain)
 [36-416]  5.90000000000008e-79 G3DSA:3.40.710.10
G3DSA:3.40.710.10   G3DSA:3.40.710.10
 [30-417]  6.40004254961849e-83 SSF56601
SSF56601   PBP_transp_fold
SignalP
 [1-17]  0.889 Signal
Eukaryota   
TMHMM No significant hit