close all open/close all

CDS information : Epoth_00030


close this sectionLocation

Organism
StrainSo ce90
Entry nameEpothilone
Contig
Start / Stop / Direction3,415 / 5,556 / + [in whole cluster]
3,415 / 5,556 / + [in contig]
Location3415..5556 [in whole cluster]
3415..5556 [in contig]
TypeCDS
Length2,142 bp (713 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF3; similar to Na/H and drug/H antiporters
Reference
ACC
PmId
[10662695] The biosynthetic gene cluster for the microtubule-stabilizing agents epothilones A and B from Sorangium cellulosum So ce90. (Chem Biol. , 2000)
Family/Domain
FD
IPR006153

close this sectionSequence

selected fasta
>putative transporter [unknown]
MHGLTERQVLLSLVTLALILVTARASGELARRLRQPEVLGELFGGVVLGPSVVGALAPGF
HRALFQEPAVGVVLSGISWIGALLLLLMAGIEVDVGILRKEARPGALSALGAIAPPLAAG
AAFSALVLDRPLPSGLFLGIVLSVTAVSVIAKVLIERESMRRSYAQVTLAAGVVSEVAAW
VLVAMTSSSYGASPALAVARSALLASGFLLFMVLVGRRLTHLAMRWVADATRVSKGQVSL
VLVLTFLAAALTQRLGLHPLLGAFALGVLLNSAPRTNRPLLDGVQTLVAGLFAPVFFVLA
GMRVDVSQLRTPAAWGTVALLLATATAAKVVPAALGARLGGLRGSEAALVAVGLNMKGGT
DLIVAIVGVELGLLSNEAYTMYAVVALVTVTASPALLIWLEKRAPPTQEESARLEREEAA
RRAYIPGVERILVPIVAHALPGFATDIVESIVASKRKLGETVDITELSVEQQAPGPSRAA
GEASRGLARLGARLRVGIWRQRRELRGSIQAILRASRDHDLLVIGARSPARARGMSFGRL
QDAIVQRAESNVLVVVGDPPAAERASARRILVPIIGLEYSFAAADLAAHVALAWDAELVL
LSSAQTDPGAVVWRDREPSRVRAVARSVVDEAVFRGRRLGVRVSSRVHVGAHPSDEITRE
LARAPYDLLVLGCYDHGPLGRLYLGSTVESVVVRSRVPVALLVAHGGTREQVR
selected fasta
>putative transporter [unknown]
ATGCACGGCCTCACCGAGCGGCAGGTCCTGCTCTCGCTCGTCACCCTCGCGCTCATCCTC
GTGACCGCGCGCGCCTCCGGCGAGCTCGCGCGGCGGCTGCGCCAGCCCGAGGTGCTCGGG
GAGCTCTTCGGCGGCGTCGTGCTGGGCCCCTCCGTCGTCGGCGCGCTCGCGCCCGGGTTC
CATCGAGCCCTCTTCCAGGAGCCGGCGGTCGGGGTCGTGCTCTCGGGCATCTCCTGGATA
GGCGCGCTCCTCCTGCTGCTGATGGCGGGCATCGAGGTCGACGTGGGCATCCTGCGCAAG
GAGGCGCGCCCCGGGGCGCTCTCGGCGCTCGGCGCGATCGCGCCCCCGCTCGCGGCGGGC
GCCGCCTTCTCGGCGCTCGTGCTCGATCGGCCCCTTCCGAGCGGCCTCTTCCTCGGGATC
GTGCTCTCGGTGACGGCGGTCAGCGTGATCGCGAAGGTGCTGATCGAGCGCGAGTCGATG
CGCCGCAGCTATGCGCAGGTGACGCTCGCGGCGGGGGTGGTCAGCGAGGTCGCTGCCTGG
GTGCTCGTCGCGATGACGTCGTCGAGCTACGGCGCGTCGCCCGCGCTGGCGGTCGCCCGG
AGCGCGCTCCTGGCGAGCGGATTCTTGCTGTTCATGGTGCTCGTCGGGCGGCGGCTCACC
CACCTCGCGATGCGCTGGGTGGCCGACGCGACGCGCGTCTCCAAGGGACAGGTGTCGCTC
GTCCTCGTCCTCACGTTCCTGGCCGCGGCGCTGACGCAGCGGCTCGGCCTGCACCCGCTG
CTCGGCGCGTTCGCGCTCGGCGTGCTGCTCAACAGCGCTCCTCGCACCAACCGCCCTCTC
CTCGACGGCGTGCAGACGCTCGTGGCGGGCCTCTTCGCGCCTGTGTTCTTCGTCCTCGCG
GGCATGCGCGTCGACGTGTCGCAGCTGCGCACGCCGGCGGCGTGGGGGACGGTCGCGTTG
CTGCTGGCGACCGCGACGGCGGCGAAGGTCGTCCCCGCCGCGCTCGGCGCGCGGCTCGGC
GGGCTCAGGGGCAGCGAGGCGGCGCTCGTGGCGGTGGGCCTGAACATGAAGGGCGGCACG
GACCTCATCGTCGCGATCGTCGGCGTCGAGCTCGGGCTCCTCTCCAACGAGGCTTATACG
ATGTACGCCGTCGTCGCGCTGGTCACGGTGACCGCCTCACCCGCGCTCCTCATCTGGCTC
GAGAAAAGGGCGCCTCCGACGCAGGAGGAGTCGGCTCGCCTCGAGCGCGAGGAGGCCGCG
AGGCGCGCGTACATCCCCGGGGTCGAGCGGATCCTCGTCCCGATCGTGGCGCACGCCCTG
CCCGGGTTCGCCACGGACATCGTGGAGAGCATCGTCGCCTCCAAGCGAAAGCTCGGCGAG
ACGGTCGACATCACGGAGCTCTCCGTGGAGCAGCAGGCGCCCGGCCCATCGCGCGCCGCG
GGGGAGGCGAGCCGGGGGCTCGCGAGGCTCGGCGCGCGCCTCCGCGTCGGCATCTGGCGG
CAAAGGCGCGAGCTGCGCGGCTCGATCCAGGCGATCCTGCGCGCCTCGCGGGATCACGAT
CTGCTCGTGATCGGCGCGCGATCGCCGGCGCGCGCGCGCGGAATGTCGTTCGGTCGCCTG
CAGGACGCGATCGTCCAGCGGGCCGAGTCCAACGTGCTCGTCGTGGTGGGCGACCCTCCG
GCGGCGGAGCGCGCCTCCGCGCGGCGGATCCTCGTCCCGATCATCGGCCTCGAGTACTCC
TTCGCCGCCGCCGATCTCGCGGCCCACGTGGCGCTGGCGTGGGACGCCGAGCTCGTGCTG
CTCAGCAGCGCGCAGACCGATCCGGGCGCGGTCGTCTGGCGCGATCGCGAGCCATCCCGG
GTGCGCGCGGTGGCGCGGAGCGTCGTCGACGAGGCGGTCTTCCGGGGGCGCCGGCTCGGC
GTGCGCGTCTCGTCGCGCGTGCACGTGGGCGCGCACCCGAGCGACGAGATAACGCGGGAG
CTCGCGCGCGCCCCGTACGATCTGCTCGTGCTCGGATGCTACGACCATGGGCCGCTCGGC
CGGCTCTACCTCGGCAGCACGGTCGAGTCGGTGGTGGTCCGGAGCCGGGTGCCGGTCGCG
TTGCTCGTCGCGCATGGAGGGACTCGAGAGCAGGTGAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006016 UspA (Domain)
 [568-701]  2.1e-14 PF00582
PF00582   Usp
IPR006153 Cation/H+ exchanger (Domain)
 [15-396]  4.2e-53 PF00999
PF00999   Na_H_Exchanger
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [510-555]  5.30000000000001e-28 G3DSA:3.40.50.620 [563-701]  5.30000000000001e-28 G3DSA:3.40.50.620
G3DSA:3.40.50.620   Rossmann-like_a/b/a_fold
SignalP
 [1-25]  0.951 Signal
Bacteria, Gram-negative   
 [1-25]  0.982 Signal
Eukaryota   
 [1-25]  0.986 Signal
Bacteria, Gram-positive   
TMHMM
 [10-27]  Transmembrane (o-i) [39-61]  Transmembrane (i-o) [71-93]  Transmembrane (o-i) [106-128]  Transmembrane (i-o) [133-155]  Transmembrane (o-i) [167-186]  Transmembrane (i-o) [196-215]  Transmembrane (o-i) [236-258]  Transmembrane (i-o) [278-300]  Transmembrane (o-i) [313-335]  Transmembrane (i-o) [378-400]  Transmembrane (o-i)
Transmembrane 11