close all open/close all

CDS information : Epoth_00090


close this sectionLocation

Organism
StrainSo ce90
Entry nameEpothilone
Contig
Start / Stop / Direction21,746 / 43,519 / + [in whole cluster]
21,746 / 43,519 / + [in contig]
Location21746..43519 [in whole cluster]
21746..43519 [in contig]
TypeCDS
Length21,774 bp (7,257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)epoC
EC number
Keyword
Note
Note (GenBank)
  • EPOS C
Reference
ACC
PmId
[10662695] The biosynthetic gene cluster for the microtubule-stabilizing agents epothilones A and B from Sorangium cellulosum So ce90. (Chem Biol. , 2000)
[11217802] Studies on the biosynthesis of epothilones: the biosynthetic origin of the carbon skeleton. (J Antibiot (Tokyo). , 2000)
Related Reference
ACC
Q9KIZ7
PmId
[10649995] Cloning and heterologous expression of the epothilone gene cluster. (Science. , 2000)
[10831849] Isolation and characterization of the epothilone biosynthetic gene cluster from Sorangium cellulosum. (Gene. , 2000)

close this sectionPKS/NRPS Module

3 malonyl-CoA
4 malonyl-CoA for Epothilone A
methylmalonyl-CoA for Epothilone B
5 malonyl-CoA
6 methylmalonyl-CoA
not conserved YASHS(Y->V)
KS39..408
AT563..848
KR1149..1338
ACP1433..1503
KS1525..1898
AT2056..2341
KR2647..2836
ACP2932..3002
KS3023..3397
AT3555..3861
DH3917..4083
ER4416..4718
KR4731..4910
ACP5005..5079
KS5102..5477
AT5630..5948
DH5998..6166
ER6525..6836
KR6859..7039
ACP7139..7208

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MTTRGPTAQQNPLKQAAIIIQRLEERLAGLAQAELERTEPIAIVGIGCRFPGGADAPEAF
WELLDAERDAVQPLDMRWALVGVAPVEAVPHWAGLLTEPIDCFDAAFFGISPREARSLDP
QHRLLLEVAWEGLEDAGIPPRSIDGSRTGVFVGAFTADYARTVARLPREERDAYSATGNM
LSIAAGRLSYTLGLQGPCLTVDTACSSSLVAIHLACRSLRAGESDLALAGGVSALLSPDM
MEAAARTQALSPDGRCRTFDASANGFVRGEGCGLVVLKRLSDAQRDGDRIWALIRGSAIN
HDGRSTGLTAPNVLAQETVLREALRSAHVEAGAVDYVETHGTGTSLGDPIEVEALRATVG
PARSDGTRCVLGAVKTNIGHLEAAAGVAGLIKAALSLTHERIPRNLNFRTLNPRIRLEGS
ALALATEPVPWPRTDRPRFAGVSSFGMSGTNAHVVLEEAPAVELWPAAPERSAELLVLSG
KSEGALDAQAARLREHLDMHPELGLGDVAFSLATTRSAMSHRLAVAVTSREGLLAALSAV
AQGQTPAGAARCIASSSRGKLAFLFTGQGAQTPGMGRGLCAAWPAFREAFDRCVALFDRE
LDRPLREVMWAEAGSAESLLLDQTAFTQPALFAVEYALTALWRSWGVEPELLVGHSIGEL
VAACVAGVFSLEDGVRLVAARGRLMQGLSAGGAMVSLGAPEAEVAAAVAPHAASVSIAAV
NGPEQVVIAGVEQAVQAIAAGFAARGARTKRLHVSHAFHSPLMEPMLEEFGRVAASVTYR
RPSVSLVSNLSGKVVTDELSAPGYWVRHVREAVRFADGVKALHEAGAGTFVEVGPKPTLL
GLLPACLPEAEPTLLASLRAGREEAAGVLEALGRLWAAGGSVSWPGVFPTAGRRVPLPTY
PWQRQRYWIEAPAEGLGATAADALAQWFYRVDWPEMPRSSVDSRRARSGGWLVLADRGGV
GEAAAAALSSQGCSCAVLHAPAEASAVAEQVTQALGGRNDWQGVLYLWGLDAVVEAGASA
EEVAKVTHLAAAPVLALIQALGTGPRSPRLWIVTRGACTVGGEPDAAPCQAALWGMGRVA
ALEHPGSWGGLVDLDPEESPTEVEALVAELLSPDAEDQLAFRQGRRRAARLVAAPPEGNA
APVSLSAEGSYLVTGGLGALGLLVARWLVERGAGHLVLISRHGLPDREEWGRDQPPEVRA
RIAAIEALEAQGARVTVAAVDVADAEGMAALLAAVEPPLRGVVHAAGLLDDGLLAHQDAG
RLARVLRPKVEGAWVLHTLTREQPLDLFVLFSSASGVFGSIGQGSYAAGNAFLDALADLR
RTQGLAALSIAWGLWAEGGMGSQAQRREHEASGIWAMPTSRALAAMEWLLGTRATQRVVI
QMDWAHAGAAPRDASRGRFWDRLVTATKEASSSAVPAVERWRNASVVETRSALYELVRGV
VAGVMGFTDQGTLDVRRGFAEQGLDSLMAVEIRKRLQGELGMPLSATLAFDHPTVERLVE
YLLSQALELQDRTDVRSVRLPATEDPIAIVGAACRFPGGVEDLESYWQLLTEGVVVSTEV
PADRWNGADGRVPGSGEAQRQTYVPRGGFLREVETFDAAFFHISPREAMSLDPQQRLLLE
VSWEAIERAGQDPSALRESPTGVFVGAGPNEYAERVQELADEAAGLYSGTGNMLSVAAGR
LSFFLGLHGPTLAVDTACSSSLVALHLGCQSLRRGECDQALVGGVNMLLSPKTFALLSRM
HALSPGGRCKTFSADADGYARAEGCAVVVLKRLSDAQRDRDPILAVIRGTAINHDGPSSG
LTVPSGPAQEALLRQALAHAGVVPADVDFVECHGTGTALGDPIEVRALSDVYGQARPADR
PLILGAAKANLGHMEPAAGLAGLLKAVLALGQEQIPAQPELGELNPLLPWEALPVAVARA
AVPWPRTDRPRFAGVSSFGMSGTNAHVVLEEAPAVELWPAAPERSAELLVLSGKSEGALD
AQAARLREHLDMHPELGLGDVAFSLATTRSAMNHRLAVAVTSREGLLAALSAVAQGQTPP
GAARCIASSSRGKLAFLFTGQGAQTPGMGRGLCAAWPAFREAFDRCVALFDRELDRPLRE
VMWAEPGSAESLLLDQTAFTQPALFTVEYALTALWRSWGVEPELVAGHSAGELVAACVAG
VFSLEDGVRLVAARGRLMQGLSAGGAMVSLGAPEAEVAAAVAPHAASVSIAAVNGPEQVV
IAGVEQAVQAIAAGFAARGARTKRLHVSHASHSPLMEPMLEEFGRVAASVTYRRPSVSLV
SNLSGKVVADELSAPGYWVRHVREAVRFADGVKALHEAGAGTFVEVGPKPTLLGLLPACL
PEAEPTLLASLRAGREEAAGVLEALGRLWAAGGSVSWPGVFPTAGRRVPLPTYPWQRQRY
WPDIEPDSRRHAAADPTQGWFYRVDWPEIPRSLQKSEEASRGSWLVLADKGGVGEAVAAA
LSTRGLPCVVLHAPAETSATAELVTEAAGGRSDWQVVLYLWGLDAVVGAEASIDEIGDAT
RRATAPVLGLARFLSTVSCSPRLWVVTRGACIVGDEPAIAPCQAALWGMGRVAALEHPGA
WGGLVDLDPRASPPQASPIDGEMLVTELLSQETEDQLAFRHGRRHAARLVAAPPQGQAAP
VSLSAEASYLVTGGLGGLGLIVAQWLVELGARHLVLTSRRGLPDRQAWCEQQPPEIRARI
AAVEALEARGARVTVAAVDVADVEPMTALVSSVEPPLRGVVHAAGVSVMRPLAETDETLL
ESVLRPKVAGSWLLHRLLHGRPLDLFVLFSSGAAVWGSHSQGAYAAANAFLDGLAHLRRS
QSLPALSVAWGLWAEGGMADAEAHARLSDIGVLPMSTSAALSALQRLVETGAAQRTVTRM
DWARFAPVYTARGRRNLLSALVAGRDIIAPSPPAAATRNWRGLSVAEARVALHEIVHGAV
ARVLGFLDPSALDPGMGFNEQGLDSLMAVEIRNLLQAELDVRLSTTLAFDHPTVQRLVEH
LLVDVLKLEDRSDTQHVRSLASDEPIAIVGAACRFPGGVEDLESYWQLLAEGVVVSAEVP
ADRWDAADWYDPDPEIPGRTYVTKGAFLRDLQRLDATFFRISPREAMSLDPQQRLLLEVS
WEALESAGIAPDTLRDSPTGVFVGAGPNEYYTQRLRGFTDGAAGLYGGTGNMLSVTAGRL
SFFLGLHGPTLAMDTACSSSLVALHLACQSLRLGECDQALVGGVNVLLAPETFVLLSRMR
ALSPDGRCKTFSADADGYARGEGCAVVVLKRLRDAQRAGDSILALIRGSAVNHDGPSSGL
TVPNGPAQQALLRQALSQAGVSPVDVDFVECHGTGTALGDPIEVQALSEVYGPGRSGDRP
LVLGAAKANVAHLEAASGLASLLKAVLALRHEQIPAQPELGELNPHLPWNTLPVAVPRKA
VPWGRGARPRRAGVSAFGLSGTNVHVVLEEAPEVEPAPAAPARPVELVVLSAKSAAALDA
AAARLSAHLSAHPELSLGDVAFSLATTRSPMEHRLAIATTSREALRGALDAAAQQKTPQG
AVRGKAVSSRGKLAFLFTGQGAQMPGMGRGLYETWPAFREAFDRCVALFDREIDQPLREV
MWAAPGLAQAARLDQTAYAQPALFALEYALAALWRSWGVEPHVLLGHSIGELVAACVAGV
FSLEDAVRLVAARGRLMQALPAGGAMVAIAASEAEVAASVAPHAATVSIAAVNGPDAVVI
AGAEVQVLALGATFAARGIRTKRLAVSHAFHSPLMDPMLEDFQRVAATIAYRAPDRPVVS
NVTGHVAGPEIATPEYWVRHVRSAVRFGDGAKALHAAGAATFVEVGPKPVLLGLLPACLG
EADAVLVPSLRADRSECEVVLAALGAWYAWGGALDWKGVFPDGARRVALPMYPWQRERHW
MDLTPRSAAPAGIAGRWPLAGVGLCMPGAVLHHVLSIGPRHQPFLGDHLVFGKVVVPGAF
HVAVILSIAAERWPERAIELTGVEFLKAIAMEPDQEVELHAVLTPEAAGDGYLFELATLA
APETERRWTTHARGRVQPTDGAPGALPRLEVLEDRAIQPLDFAGFLDRLSAVRIGWGPLW
RWLQDGRVGDEASLATLVPTYPNAHDVAPLHPILLDNGFAVSLLSTRSEPEDDGTPPLPF
AVERVRWWRAPVGRVRCGGVPRSQAFGVSSFVLVDETGEVVAEVEGFVCRRAPREVFLRQ
ESGASTAALYRLDWPEAPLPDAPAERIEESWVVVAAPGSEMAAALATRLNRCVLAEPKGL
EAALAGVSPAGVICLWEAGAHEEAPAAAQRVATEGLSVVQALRDRAVRLWWVTMGAVAVE
AGERVQVATAPVWGLGRTVMQERPELSCTLVDLEPEADAARSADVLLRELGRADDETQVA
FRSGKRRVARLVKATTPEGLLVPDAESYRLEAGQKGTLDQLRLAPAQRRAPGPGEVEIKV
TASGLNFRTVLAVLGMYPGDAGPMGGDCAGVATAVGQGVRHVAVGDAVMTLGTLHRFVTV
DARLVVRQPAGLTPAQAATVPVAFLTAWLALHDLGNLRRGERVLIHAAAGGVGMAAVQIA
RWIGAEVFATASPSKWAAVQAMGVPRTHIASSRTLEFAETFRQVTGGRGVDVVLNALAGE
FVDASLSLLSTGGRFLEMGKTDIRDRAAVAAAHPGVRYRVFDILELAPDRTREILERVVE
GFAAGHLRALPVHAFAITKAEAAFRFMAQARHQGKVVLLPAPSAAPLAPTGTVLLTGGLG
ALGLHVARWLAQQGVPHMVLTGRRGLDTPGAAKAVAEIEALGARVTIAASDVADRNALEA
VLQAIPAEWPLQGVIHAAGALDDGVLDEQTTDRFSRVLAPKVTGAWNLHELTAGNDLAFF
VLFSSMSGLLGSAGQSNYAAANTFLDALAAHRRAEGLAAQSLAWGPWSDGGMAAGLSAAL
QARLARHGMGALSPAQGTALLGQALARPETQLGAMSLDVRAASQASGAAVPPVWRALVRA
EARHTAAGAQGALAARLGALPEARRADEVRKVVQAEIARVLSWSAASAVPVDRPLSDLGL
DSLTAVELRNVLGQRVGATLPATLAFDHPTVDALTRWLLDKVLAVAEPSVSSAKSSPQVA
LDEPIAIIGIGCRFPGGVADPESFWRLLEEGSDAVVEVPHERWDIDAFYDPDPDVRGKMT
TRFGGFLSDIDRFDPAFFGISPREATTMDPQQRLLLETSWEAFERAGILPERLMGSDTGV
FVGLFYQEYAALAGGIEAFDGYLGTGTTASVASGRISYVLGLKGPSLTVDTACSSSLVAV
HLACQALRRGECSVALAGGVALMLTPATFVEFSRLRGLAPDGRCKSFSAAADGVGWSEGC
AMLLLKPLRDAQRDGDPILAVIRGTAVNQDGRSNGLTAPNGSSQQEVIRRALEQAGLAPA
DVSYVECHGTGTTLGDPIEVQALGAVLAQGRPSDRPLVIGSVKSNIGHTQAAAGVAGVIK
VALALERGLIPRSLHFDAPNPHIPWSELAVQVAAKPVEWTRNGVPRRAGVSSFGVSGTNA
HVVLEEAPAAAFAPAAARSAELFVLSAKSAAALDAQAARLSAHVVAHPELGLGDLAFSLA
TTRSPMTYRLAVAATSREALSAALDTAAQGQAPPAAARGHASTGSAPKVVFVFPGQGSQW
LGMGQKLLSEEPVFRDALSACDRAIQAEAGWSLLAELAADETTSQLGRIDVVQPALFAIE
VALSALWRSWGVEPDAVVGHSMGEVAAAHVAGALSLEDAVAIICRRSLLLRRISGQGEMA
VVELSLAEAEAALLGYEDRLSVAVSNSPRSTVLAGEPAALAEVLAILAAKGVFCRRVKVD
VASHSPQIDPLRDELLAALGELEPRQATVSMRSTVTSTIMAGPELVASYWADNVRQPVRF
AEAVQSLMEDGHGLFVEMSPHPILTTSVEEIRRATKREGVAVGSLRRGQDERLSMLEALG
ALWVHGQAVGWERLFSAGGAGLRRVPLPTYPWQRERYWVDAPTGGAAGGSRFAHAGSHPL
LGEMQTLSTQRSTRVWETTLDLKRLPWLGDHRVQGAVVFPGAAYLEMALSSGAEALGDGP
LQVSDVVLAEALAFADDTPAAVQVMATEERPGRLQFHVASRVPGHGGAAFRSHARGVLRQ
IERAEVPARLDLAALRARLQASAPAAATYAALAEMGLEYGPAFQGLVELWRGEGEALGRV
RLPEAAGSPAACRLHPALLDACFHVSSAFADRGEATPWVPVEIGSLRWFQRPSGELWCHA
RSVSHGKPTPDRRSTDFWVVDSTGAIVAEISGLVAQRLAGGVRRREEDDWFMEPAWEPTA
VPGSEVMAGRWLLIGSGGGLGAALHSALTEAGHSVVHATGRGTSAAGLQALLTASFDGQA
PTSVVHLGSLDERGVLDADAPFDADALEESLVRGCDSVLWTVQAVAGAGFRDPPRLWLVT
RGAQAIGAGDVSVAQAPLLGLGRVIALEHAELRCARIDLDPARRDGEVDELLAELLADDA
EEEVAFRGGERRVARLVRRLPETDCREKIEPAEGRPFRLEIDGSGVLDDLVLRATERRPP
GPGEVEIAVEAAGLNFLDVMRAMGIYPGPGDGPVALGAECSGRIVAMGEGVESLRIGQDV
VAVAPFSFGTHVTIDARMLAPRPAALTAAQAAALPVAFMTAWYGLVHLGRLRAGERVLIH
SATGGTGLAAVQIARHLGAEIFATAGTPEKRAWLREQGIAHVMDSRSLDFAEQVLAATKG
EGVDVVLNSLSGAAIDASLSTLVPDGRFIELGKTDIYADRSLGLAHFRKSLSYSAVDLAG
LAVRRPERVAALLAEVVDLLARGALQPLPVEIFPLSRAADAFRKMAQAQHLGKLVLALED
PDVRIRVPGESGVAIRADGAYLVTGGLGGLGLSVAGWLAEQGAGHLVLVGRSGAVSAEQQ
TAVAALEAHGARVTVARADVADRAQMERILREVTASGMPLRGVVHAAGILDDGLLMQQTP
ARFRAVMAPKVRGALHLHALTREAPLSFFVLYASGAGLLGSPGQGNYAAANTFLDALAHH
RRAQGLPALSIDWGLFADVGLAAGQQNRGARLVTRGTRSLTPDEGLWALERLLDGDRTQA
GVMPFDVRQWVEFYPAAASSRRLSRLMTARRVASGRLAGDRDLLERLATAEAGARAGMLQ
EVVRAQVSQVLRLSEGKLDVDAPLTSLGMDSLMGLELRNRIEAVLGITMPATLLWTYPTV
AALSAHLASHVVSTGDGESARPPDTGSVAPTTHEVASLDEDGLFALIDESLARAGKR
selected fasta
>polyketide synthase [polyketide synthase]
ATGACTACTCGCGGTCCTACGGCACAGCAGAATCCGCTGAAACAAGCGGCCATCATCATT
CAGCGGCTGGAGGAGCGGCTCGCTGGGCTCGCACAGGCGGAGCTGGAACGGACCGAGCCG
ATCGCCATCGTCGGTATCGGCTGCCGCTTCCCTGGCGGTGCGGACGCTCCGGAAGCGTTT
TGGGAGCTGCTCGACGCGGAGCGCGACGCGGTCCAGCCGCTCGACATGCGCTGGGCGCTG
GTGGGTGTCGCTCCCGTCGAGGCCGTGCCGCACTGGGCGGGGCTGCTCACCGAGCCGATA
GATTGCTTCGATGCTGCGTTCTTCGGCATCTCGCCTCGGGAGGCGCGATCGCTCGACCCG
CAGCATCGTCTGTTGCTGGAGGTCGCTTGGGAGGGGCTCGAGGACGCCGGTATCCCGCCC
CGGTCCATCGACGGGAGCCGCACCGGTGTGTTCGTCGGCGCTTTCACGGCGGACTACGCG
CGCACGGTCGCTCGGCTGCCGCGCGAGGAGCGAGACGCGTACAGCGCCACCGGCAACATG
CTCAGCATCGCCGCCGGACGGCTGTCGTACACGCTGGGGTTGCAGGGACCTTGCCTGACC
GTCGACACGGCGTGCTCGTCATCGCTGGTGGCGATTCACCTCGCCTGCCGCAGCCTGCGC
GCAGGAGAGAGCGATCTCGCGTTGGCGGGAGGGGTCAGCGCGCTCCTCTCCCCCGACATG
ATGGAAGCCGCGGCGCGCACGCAAGCGCTGTCGCCCGATGGTCGTTGCCGGACCTTCGAT
GCTTCGGCCAACGGGTTCGTCCGTGGCGAGGGCTGTGGCCTGGTCGTCCTCAAACGGCTC
TCCGACGCGCAACGGGATGGCGACCGCATCTGGGCGCTGATCCGGGGCTCGGCCATCAAC
CATGATGGCCGGTCGACCGGGTTGACCGCGCCCAACGTGCTGGCTCAGGAGACGGTCTTG
CGCGAGGCGCTGCGGAGCGCCCACGTCGAAGCTGGGGCCGTCGATTACGTCGAGACCCAC
GGAACAGGGACCTCGCTGGGCGATCCCATCGAGGTCGAGGCGCTGCGGGCGACGGTGGGG
CCGGCGCGCTCCGACGGCACACGCTGCGTGCTGGGCGCGGTGAAGACCAACATCGGCCAT
CTCGAGGCCGCGGCAGGCGTAGCGGGCCTGATCAAGGCAGCGCTTTCGCTGACGCACGAG
CGCATCCCGAGAAACCTCAACTTCCGCACGCTCAATCCGCGGATCCGGCTCGAGGGCAGC
GCGCTCGCGTTGGCGACCGAGCCGGTGCCGTGGCCGCGCACGGACCGCCCGCGCTTCGCG
GGGGTGAGCTCGTTCGGGATGAGCGGAACGAACGCGCATGTGGTGCTGGAAGAGGCGCCG
GCGGTGGAGCTGTGGCCTGCCGCGCCGGAGCGCTCGGCGGAGCTTTTGGTGCTGTCGGGC
AAGAGCGAGGGGGCGCTCGATGCGCAGGCGGCGCGGCTGCGCGAGCACCTGGACATGCAC
CCGGAGCTCGGGCTCGGGGACGTGGCGTTCAGCCTGGCGACGACGCGCAGCGCGATGAGC
CACCGGCTCGCGGTGGCGGTGACGTCGCGCGAGGGGCTGCTGGCGGCGCTCTCGGCCGTG
GCGCAGGGGCAGACGCCGGCGGGGGCGGCGCGCTGCATCGCGAGCTCCTCGCGCGGCAAG
CTGGCGTTCCTGTTCACCGGACAGGGCGCGCAGACGCCGGGCATGGGCCGGGGGCTTTGC
GCGGCGTGGCCAGCGTTCCGGGAGGCGTTCGACCGGTGCGTGGCGCTGTTCGACCGGGAG
CTGGACCGCCCGCTGCGCGAGGTGATGTGGGCGGAGGCGGGGAGCGCCGAGTCGTTGTTG
CTCGACCAGACGGCGTTCACCCAGCCCGCGCTCTTCGCGGTGGAGTACGCGCTGACGGCG
CTGTGGCGGTCGTGGGGCGTAGAGCCGGAGCTCCTGGTTGGGCATAGCATCGGGGAGCTG
GTGGCGGCGTGCGTGGCGGGGGTGTTCTCGCTGGAAGATGGGGTGAGGCTCGTGGCGGCG
CGCGGGCGGCTGATGCAGGGGCTCTCGGCGGGCGGCGCGATGGTGTCGCTCGGAGCGCCG
GAGGCGGAGGTGGCGGCGGCGGTGGCGCCGCACGCGGCGTCGGTGTCGATCGCGGCGGTC
AATGGGCCGGAGCAGGTGGTGATCGCGGGCGTGGAGCAAGCGGTGCAGGCGATCGCGGCG
GGGTTCGCGGCGCGCGGCGCGCGCACCAAGCGGCTGCATGTCTCGCACGCGTTCCACTCG
CCGCTGATGGAACCGATGCTGGAGGAGTTCGGGCGGGTGGCGGCGTCGGTGACGTACCGG
CGGCCAAGCGTTTCGCTGGTGAGCAACCTGAGCGGGAAGGTGGTCACGGACGAGCTGAGC
GCGCCGGGGTACTGGGTGCGGCACGTGCGGGAGGCGGTGCGCTTCGCGGACGGGGTGAAG
GCGCTGCACGAAGCCGGCGCGGGGACGTTCGTCGAAGTGGGCCCGAAGCCGACGCTGCTC
GGGCTGTTGCCAGCCTGCCTGCCGGAGGCGGAGCCGACGCTGCTGGCGTCGTTGCGCGCC
GGGCGCGAGGAGGCTGCGGGGGTGCTCGAGGCGCTGGGCAGGCTGTGGGCCGCCGGCGGC
TCGGTCAGCTGGCCGGGCGTCTTCCCCACGGCTGGGCGGCGGGTGCCGCTGCCGACCTAT
CCGTGGCAGCGGCAGCGGTACTGGATCGAGGCGCCGGCCGAAGGGCTCGGAGCCACGGCC
GCCGATGCGCTGGCGCAGTGGTTCTACCGGGTGGACTGGCCCGAGATGCCTCGCTCATCC
GTGGATTCGCGGCGAGCCCGGTCCGGCGGGTGGCTGGTGCTGGCCGACCGGGGTGGAGTC
GGGGAGGCGGCCGCGGCGGCGCTTTCGTCGCAGGGATGTTCGTGCGCCGTGCTCCATGCG
CCCGCCGAGGCCTCCGCGGTTGCCGAGCAGGTGACCCAGGCCCTCGGTGGCCGCAACGAC
TGGCAGGGGGTGCTGTACCTGTGGGGTCTGGACGCCGTCGTGGAGGCGGGGGCATCGGCC
GAAGAGGTCGCCAAAGTCACCCATCTTGCCGCGGCGCCGGTGCTCGCGCTGATTCAGGCG
CTCGGCACGGGGCCGCGCTCACCCCGGCTCTGGATCGTGACCCGAGGGGCCTGCACGGTG
GGCGGCGAGCCTGACGCTGCCCCCTGTCAGGCGGCGCTGTGGGGTATGGGCCGGGTCGCG
GCGCTAGAGCATCCCGGCTCCTGGGGCGGGCTCGTGGACCTGGATCCGGAGGAGAGCCCG
ACGGAGGTCGAGGCCCTGGTGGCCGAGCTGCTTTCGCCGGACGCCGAGGATCAGCTGGCA
TTCCGCCAGGGGCGCCGGCGCGCAGCGCGGCTTGTGGCCGCCCCACCGGAGGGAAACGCA
GCGCCGGTGTCGCTGTCTGCGGAGGGGAGTTACTTGGTGACGGGTGGGCTGGGCGCCCTT
GGCCTCCTCGTTGCGCGGTGGTTGGTGGAGCGCGGGGCGGGGCACCTTGTGCTGATCAGC
CGGCACGGATTGCCCGACCGCGAGGAATGGGGCCGAGATCAGCCGCCAGAGGTGCGCGCG
CGCATTGCGGCGATCGAGGCGCTGGAGGCGCAGGGCGCGCGGGTCACCGTGGCGGCGGTC
GACGTGGCCGATGCCGAAGGCATGGCGGCGCTCTTGGCGGCCGTCGAGCCGCCGCTGCGG
GGGGTAGTGCACGCCGCGGGTCTGCTCGACGACGGGCTGCTGGCCCACCAGGACGCTGGT
CGGCTCGCCCGGGTGTTGCGCCCCAAGGTGGAGGGGGCATGGGTGCTGCACACCCTTACC
CGCGAGCAGCCGCTGGACCTCTTCGTACTGTTTTCCTCGGCGTCGGGCGTCTTCGGCTCG
ATCGGCCAGGGCAGCTACGCGGCAGGCAATGCCTTTTTGGACGCGCTGGCGGACCTCCGC
CGAACGCAGGGGCTCGCCGCCCTGAGCATCGCCTGGGGCCTGTGGGCGGAGGGGGGGATG
GGCTCGCAGGCGCAGCGCCGGGAACACGAGGCATCGGGAATCTGGGCGATGCCGACGAGT
CGGGCCCTGGCGGCGATGGAATGGCTGCTCGGTACGCGCGCGACGCAGCGCGTGGTCATC
CAGATGGATTGGGCCCATGCGGGAGCGGCGCCGCGCGACGCGAGCCGAGGCCGCTTCTGG
GATCGGCTGGTAACTGCCACGAAAGAGGCCTCCTCCTCGGCCGTGCCAGCTGTGGAGCGC
TGGCGCAACGCGTCTGTTGTGGAGACCCGCTCGGCGCTCTACGAGCTTGTGCGCGGCGTG
GTCGCCGGGGTGATGGGCTTTACCGACCAGGGCACGCTCGACGTGCGACGAGGCTTCGCC
GAGCAGGGCCTCGACTCCCTGATGGCCGTGGAGATCCGCAAACGGCTTCAGGGTGAGCTG
GGTATGCCGCTGTCGGCGACGCTAGCGTTCGACCATCCGACCGTGGAGCGGCTGGTGGAA
TACTTGCTGAGCCAGGCGCTGGAGCTGCAGGACCGCACCGACGTGCGGAGCGTTCGGTTG
CCGGCGACAGAGGACCCGATCGCCATCGTGGGTGCCGCCTGCCGCTTCCCGGGCGGGGTC
GAGGACCTGGAGTCCTACTGGCAGCTGTTGACCGAGGGCGTGGTGGTCAGCACCGAGGTG
CCGGCCGACCGGTGGAATGGGGCAGACGGGCGCGTCCCCGGCTCGGGAGAGGCACAGAGA
CAGACCTACGTGCCCAGGGGTGGCTTTCTGCGCGAGGTGGAGACGTTCGATGCGGCGTTC
TTCCACATCTCGCCTCGGGAGGCGATGAGCCTGGACCCGCAACAGCGGCTGCTGCTGGAA
GTGAGCTGGGAGGCGATCGAGCGCGCGGGCCAGGACCCGTCGGCGCTGCGCGAGAGCCCC
ACGGGCGTGTTCGTGGGCGCGGGCCCCAACGAATATGCCGAGCGGGTGCAGGAACTCGCC
GATGAGGCGGCGGGGCTCTACAGCGGCACCGGCAACATGCTCAGCGTTGCGGCGGGACGG
CTATCATTTTTCCTGGGCCTGCACGGGCCGACCCTGGCTGTGGATACGGCGTGCTCCTCG
TCGCTGGTGGCGCTGCACCTCGGCTGCCAGAGCTTGCGACGGGGCGAGTGCGACCAAGCC
CTGGTTGGCGGGGTCAACATGCTGCTCTCGCCGAAGACCTTCGCGCTGCTCTCACGGATG
CACGCACTTTCGCCCGGCGGGCGGTGCAAGACGTTCTCGGCCGACGCGGACGGCTACGCG
CGGGCCGAGGGCTGCGCCGTGGTGGTGCTCAAGCGGCTCTCCGACGCGCAGCGCGACCGC
GACCCCATCCTGGCGGTGATCCGGGGTACGGCGATCAATCATGATGGCCCGAGCAGCGGG
CTGACAGTGCCCAGCGGCCCTGCCCAGGAGGCGCTGTTACGCCAGGCGCTGGCGCACGCA
GGGGTGGTTCCGGCCGACGTCGATTTCGTGGAATGCCACGGGACCGGGACGGCGCTGGGC
GACCCGATCGAGGTGCGTGCGCTGAGCGACGTGTACGGGCAAGCCCGCCCTGCGGACCGA
CCGCTGATCCTGGGAGCCGCCAAGGCCAACCTTGGGCACATGGAGCCCGCGGCGGGCCTG
GCCGGCTTGCTCAAGGCGGTGCTCGCGCTGGGGCAAGAGCAAATACCAGCCCAGCCGGAG
CTGGGCGAGCTCAACCCGCTCTTGCCGTGGGAGGCGCTGCCGGTGGCGGTGGCCCGCGCA
GCGGTGCCGTGGCCGCGCACGGACCGCCCGCGCTTCGCGGGGGTGAGCTCGTTCGGGATG
AGCGGAACGAACGCGCATGTGGTGCTGGAAGAGGCGCCGGCGGTGGAGCTGTGGCCTGCC
GCGCCGGAGCGCTCGGCGGAGCTTTTGGTGCTGTCGGGCAAGAGCGAGGGGGCGCTCGAT
GCGCAGGCGGCGCGGCTGCGCGAGCACCTGGACATGCACCCGGAGCTCGGGCTCGGGGAC
GTGGCGTTCAGCCTGGCGACGACGCGCAGCGCGATGAACCACCGGCTCGCGGTGGCGGTG
ACGTCGCGCGAGGGGCTGCTGGCGGCGCTTTCGGCCGTGGCGCAGGGGCAGACGCCGCCG
GGGGCGGCGCGCTGCATCGCGAGCTCGTCGCGCGGCAAGCTGGCGTTCCTGTTCACCGGA
CAGGGCGCGCAGACGCCGGGCATGGGCCGGGGGCTTTGCGCGGCGTGGCCAGCGTTCCGG
GAGGCGTTCGACCGGTGCGTGGCGCTGTTCGACCGGGAGCTGGACCGCCCGCTGCGCGAG
GTGATGTGGGCGGAGCCGGGGAGCGCCGAGTCGTTGTTGCTCGACCAGACGGCGTTCACC
CAGCCCGCGCTCTTCACGGTGGAGTACGCGCTGACGGCGCTGTGGCGGTCGTGGGGCGTA
GAGCCGGAGCTGGTGGCTGGGCATAGCGCCGGGGAGCTGGTGGCGGCGTGCGTGGCGGGG
GTGTTCTCGCTGGAAGATGGGGTGAGGCTCGTGGCGGCGCGCGGGCGGCTGATGCAGGGG
CTCTCGGCGGGCGGCGCGATGGTGTCGCTCGGAGCGCCGGAGGCGGAGGTGGCGGCGGCG
GTGGCGCCGCACGCGGCGTCGGTGTCGATCGCGGCGGTCAATGGGCCGGAGCAGGTGGTG
ATCGCGGGCGTGGAGCAAGCGGTGCAGGCGATCGCGGCGGGGTTCGCGGCGCGCGGCGCG
CGCACCAAGCGGCTGCATGTCTCGCACGCGTCCCACTCGCCGCTGATGGAACCGATGCTG
GAGGAGTTCGGGCGGGTGGCGGCGTCGGTGACGTACCGGCGGCCAAGCGTTTCGCTGGTG
AGCAACCTGAGCGGGAAGGTGGTCGCGGACGAGCTGAGCGCGCCGGGGTACTGGGTGCGG
CACGTGCGGGAGGCGGTGCGCTTCGCGGACGGGGTGAAGGCGCTGCACGAAGCCGGTGCG
GGCACGTTCGTCGAAGTGGGCCCGAAGCCGACGCTGCTCGGGCTGTTGCCAGCCTGCCTG
CCGGAGGCGGAGCCGACGCTGCTGGCGTCGTTGCGCGCCGGGCGCGAGGAGGCTGCGGGG
GTGCTCGAGGCGCTGGGCAGGCTGTGGGCCGCCGGCGGCTCGGTCAGCTGGCCGGGCGTC
TTCCCCACGGCTGGGCGGCGGGTGCCGCTGCCGACCTATCCGTGGCAGCGGCAGCGGTAC
TGGCCCGACATCGAGCCTGACAGCCGTCGCCACGCAGCCGCGGATCCGACCCAAGGCTGG
TTCTATCGCGTGGACTGGCCGGAGATACCTCGCAGCCTCCAGAAATCAGAGGAGGCGAGC
CGCGGGAGCTGGCTGGTATTGGCGGATAAGGGTGGAGTCGGCGAGGCGGTCGCTGCAGCG
CTGTCGACACGTGGACTTCCATGCGTCGTGCTCCATGCGCCGGCAGAGACATCCGCGACC
GCCGAGCTGGTGACCGAGGCTGCCGGCGGTCGAAGCGATTGGCAGGTAGTGCTCTACCTG
TGGGGTCTGGACGCCGTCGTCGGTGCGGAGGCGTCGATCGATGAGATCGGCGACGCGACC
CGTCGTGCTACCGCGCCGGTGCTCGGCTTGGCTCGGTTTCTGAGCACCGTGTCTTGTTCG
CCCCGACTCTGGGTCGTGACCCGGGGGGCATGCATCGTTGGCGACGAGCCTGCGATCGCC
CCTTGTCAGGCGGCGTTATGGGGCATGGGCCGGGTGGCGGCGCTCGAGCATCCCGGGGCC
TGGGGCGGGCTCGTGGACCTGGATCCCCGAGCGAGCCCGCCCCAAGCCAGCCCGATCGAC
GGCGAGATGCTCGTCACCGAGCTATTGTCGCAGGAGACCGAGGATCAGCTCGCCTTCCGC
CATGGGCGCCGGCACGCGGCACGGCTGGTGGCCGCCCCGCCACAGGGGCAAGCGGCACCG
GTGTCGCTGTCTGCGGAGGCGAGCTACCTGGTGACGGGAGGCCTCGGTGGGCTGGGCCTG
ATCGTGGCCCAGTGGCTGGTGGAGCTGGGAGCGCGGCACTTGGTGCTGACCAGCCGGCGC
GGGTTGCCCGACCGGCAGGCGTGGTGCGAGCAGCAGCCGCCTGAGATCCGCGCGCGGATC
GCAGCGGTCGAGGCGCTGGAGGCGCGGGGTGCACGGGTGACCGTGGCAGCGGTGGACGTG
GCCGACGTCGAACCGATGACAGCGCTGGTTTCGTCGGTCGAGCCCCCGCTGCGAGGGGTG
GTGCACGCCGCTGGCGTCAGCGTCATGCGTCCACTGGCGGAGACGGACGAGACCCTGCTC
GAGTCGGTGCTCCGTCCCAAGGTGGCCGGGAGCTGGCTGCTGCACCGGCTGCTGCACGGC
CGGCCTCTCGACCTGTTCGTGCTGTTCTCGTCGGGCGCAGCGGTGTGGGGTAGCCATAGC
CAGGGTGCGTACGCGGCGGCCAACGCTTTCCTCGACGGGCTCGCGCATCTTCGGCGTTCG
CAATCGCTGCCTGCGTTGAGCGTCGCGTGGGGTCTGTGGGCCGAGGGAGGCATGGCGGAC
GCGGAGGCTCATGCACGTCTGAGCGACATCGGGGTTCTGCCCATGTCGACGTCGGCAGCG
TTGTCGGCGCTCCAGCGCCTGGTGGAGACCGGCGCGGCTCAGCGCACGGTGACCCGGATG
GACTGGGCGCGCTTCGCGCCGGTGTACACCGCTCGAGGGCGTCGCAACCTGCTTTCGGCG
CTGGTCGCAGGGCGCGACATCATCGCGCCTTCCCCTCCGGCGGCAGCAACCCGGAACTGG
CGTGGCCTGTCCGTTGCGGAAGCCCGCGTGGCTCTGCACGAGATCGTCCATGGGGCCGTC
GCTCGGGTGCTGGGCTTCCTCGACCCGAGCGCGCTCGATCCTGGGATGGGGTTCAATGAG
CAGGGCCTCGACTCGTTGATGGCGGTGGAGATCCGCAACCTCCTTCAGGCTGAGCTGGAC
GTGCGGCTTTCGACGACGCTGGCCTTTGATCATCCGACGGTACAGCGGCTGGTGGAGCAT
CTGCTCGTCGATGTACTGAAGCTGGAGGATCGCAGCGACACCCAGCATGTTCGGTCGTTG
GCGTCAGACGAGCCCATCGCCATCGTGGGAGCCGCCTGCCGCTTCCCGGGCGGGGTGGAG
GACCTGGAGTCCTACTGGCAGCTATTGGCCGAGGGCGTGGTGGTCAGCGCCGAGGTGCCG
GCCGACCGGTGGGATGCGGCGGACTGGTACGACCCTGATCCGGAGATCCCAGGCCGGACT
TACGTGACCAAAGGCGCCTTCCTGCGCGATTTGCAGAGATTGGATGCGACCTTCTTCCGC
ATCTCGCCTCGCGAGGCGATGAGCCTCGACCCGCAGCAGCGGTTGCTCCTGGAGGTAAGC
TGGGAAGCGCTCGAGAGCGCGGGTATCGCTCCGGATACGCTGCGAGATAGCCCCACCGGG
GTGTTCGTGGGTGCGGGGCCCAATGAGTACTACACGCAGCGGCTGCGAGGCTTCACCGAC
GGAGCGGCAGGGTTGTACGGCGGCACCGGGAACATGCTCAGCGTTACGGCTGGACGGCTG
TCGTTTTTCCTGGGTCTGCACGGCCCGACGCTGGCCATGGATACGGCGTGCTCGTCATCC
CTGGTCGCGCTGCACCTCGCCTGCCAGAGCCTGCGACTGGGCGAGTGCGATCAAGCGCTG
GTTGGCGGGGTCAACGTGCTGCTCGCGCCGGAGACCTTCGTGCTGCTCTCACGGATGCGC
GCGCTTTCGCCCGACGGGCGGTGCAAGACGTTCTCGGCCGACGCGGACGGCTACGCGCGG
GGCGAGGGGTGCGCCGTGGTGGTGCTCAAGCGGCTGCGCGATGCGCAGCGCGCCGGCGAC
TCCATCCTGGCGCTGATCCGGGGAAGCGCGGTGAACCACGACGGCCCGAGCAGCGGGCTG
ACCGTACCCAACGGACCCGCCCAGCAAGCATTGCTGCGCCAGGCGCTTTCGCAAGCAGGC
GTGTCTCCGGTCGACGTTGATTTTGTGGAGTGTCACGGGACAGGGACGGCGCTGGGCGAC
CCGATCGAGGTGCAGGCGCTGAGCGAGGTGTATGGTCCAGGGCGCTCCGGGGACCGACCG
CTGGTGCTGGGGGCCGCCAAGGCCAACGTCGCGCATCTGGAGGCGGCATCTGGCTTGGCC
AGCCTGCTCAAGGCCGTGCTTGCGCTGCGGCACGAGCAGATCCCGGCCCAGCCGGAGCTG
GGGGAGCTCAACCCGCACTTGCCGTGGAACACGCTGCCGGTGGCGGTGCCACGTAAGGCG
GTGCCGTGGGGGCGCGGCGCACGCCCGCGTCGGGCCGGCGTGAGCGCGTTCGGGTTGAGC
GGAACCAACGTGCATGTCGTGCTGGAGGAGGCACCGGAGGTGGAGCCGGCGCCCGCGGCG
CCGGCGCGACCGGTGGAGCTGGTCGTGCTATCGGCCAAGAGCGCGGCGGCGCTGGACGCC
GCGGCGGCACGGCTCTCGGCGCACCTGTCCGCGCACCCGGAGCTGAGCCTCGGCGACGTG
GCGTTCAGCCTGGCGACGACGCGCAGCCCGATGGAGCACCGGCTCGCCATCGCGACGACC
TCGCGCGAGGCCCTGCGAGGCGCGCTGGACGCCGCGGCGCAGCAAAAGACGCCGCAGGGC
GCGGTGCGCGGCAAGGCCGTGTCCTCACGCGGTAAGCTGGCTTTCCTGTTCACCGGACAG
GGCGCGCAAATGCCGGGCATGGGCCGTGGGCTGTACGAAACGTGGCCTGCGTTCCGGGAG
GCGTTCGACCGGTGCGTGGCGCTCTTCGATCGGGAGATCGACCAGCCTCTGCGCGAGGTG
ATGTGGGCTGCGCCGGGCCTCGCTCAGGCGGCGCGGCTCGATCAGACCGCGTACGCGCAG
CCGGCTCTCTTTGCGCTGGAGTACGCGCTGGCTGCCCTGTGGCGTTCGTGGGGCGTGGAG
CCGCACGTACTGCTCGGTCATAGCATCGGCGAGCTGGTCGCCGCCTGCGTGGCGGGCGTG
TTCTCGCTCGAAGATGCGGTGAGGTTGGTGGCCGCGCGCGGGCGGCTGATGCAGGCGCTA
CCCGCCGGCGGTGCCATGGTAGCCATCGCAGCGTCCGAGGCCGAGGTGGCCGCCTCCGTG
GCGCCCCACGCCGCCACGGTGTCGATCGCCGCGGTCAACGGTCCTGACGCCGTCGTGATC
GCCGGCGCCGAGGTACAGGTGCTCGCCCTCGGCGCGACGTTCGCGGCGCGTGGGATACGC
ACGAAGAGGCTCGCCGTCTCCCATGCGTTCCACTCGCCGCTCATGGATCCGATGCTGGAA
GACTTCCAGCGGGTCGCTGCGACGATCGCGTACCGCGCGCCAGACCGCCCGGTGGTGTCG
AATGTCACCGGCCACGTCGCAGGCCCCGAGATCGCCACGCCCGAGTATTGGGTCCGGCAT
GTGCGAAGCGCCGTGCGCTTCGGCGACGGGGCAAAGGCGTTGCATGCCGCGGGTGCCGCC
ACGTTCGTCGAGGTTGGCCCGAAGCCGGTCCTGCTCGGGCTGTTGCCAGCGTGCCTCGGG
GAAGCGGACGCGGTCCTCGTGCCGTCGCTACGCGCGGACCGCTCGGAATGCGAGGTGGTC
CTCGCGGCGCTCGGGGCTTGGTATGCCTGGGGGGGTGCGCTCGACTGGAAGGGCGTGTTC
CCCGATGGCGCGCGCCGCGTGGCTCTGCCCATGTATCCATGGCAGCGTGAGCGCCATTGG
ATGGACCTCACCCCGCGAAGCGCCGCGCCTGCAGGGATCGCAGGTCGCTGGCCGCTGGCT
GGTGTCGGGCTCTGCATGCCCGGCGCTGTGTTGCACCACGTGCTCTCGATCGGACCACGC
CATCAGCCCTTCCTCGGTGATCACCTCGTGTTTGGCAAGGTGGTGGTGCCCGGCGCCTTT
CATGTCGCGGTGATCCTCAGCATCGCCGCCGAGCGCTGGCCCGAGCGGGCGATCGAGCTG
ACAGGCGTGGAGTTCCTGAAGGCCATCGCGATGGAGCCCGACCAGGAGGTCGAGCTCCAC
GCCGTGCTCACCCCCGAAGCCGCCGGGGATGGCTACCTGTTCGAGCTGGCGACCCTGGCG
GCGCCGGAGACCGAACGCCGATGGACGACCCACGCCCGCGGTCGGGTGCAGCCGACAGAC
GGCGCGCCCGGCGCGTTGCCGCGCCTCGAGGTGCTGGAGGACCGCGCGATCCAGCCCCTC
GACTTCGCCGGATTCCTCGACAGGTTATCGGCGGTGCGGATCGGCTGGGGTCCGCTTTGG
CGATGGCTGCAGGACGGGCGCGTCGGCGACGAGGCCTCGCTTGCCACCCTCGTGCCGACC
TATCCGAACGCCCACGACGTGGCGCCCTTGCACCCGATCCTGCTGGACAACGGCTTTGCG
GTGAGCCTGCTGTCAACCCGGAGCGAGCCGGAGGACGACGGGACGCCCCCGCTGCCGTTC
GCCGTGGAACGGGTGCGGTGGTGGCGGGCGCCGGTTGGAAGGGTGCGGTGTGGCGGCGTG
CCGCGGTCGCAGGCATTCGGTGTCTCGAGCTTCGTGCTGGTCGACGAAACTGGCGAGGTG
GTCGCCGAGGTGGAGGGATTTGTTTGCCGCCGGGCGCCGCGAGAGGTGTTCCTGCGGCAG
GAGTCGGGCGCGTCGACTGCAGCCTTGTACCGCCTCGACTGGCCCGAAGCGCCCTTGCCC
GATGCGCCTGCGGAACGGATCGAGGAGAGCTGGGTCGTGGTGGCAGCACCTGGCTCGGAG
ATGGCCGCGGCGCTCGCAACACGGCTCAACCGCTGCGTCCTCGCCGAACCCAAAGGCCTC
GAGGCGGCCCTCGCGGGGGTGTCTCCCGCAGGTGTGATCTGCCTCTGGGAGGCTGGAGCC
CACGAGGAAGCTCCGGCGGCGGCGCAGCGTGTGGCGACCGAGGGCCTCTCGGTGGTGCAG
GCGCTCAGGGACCGCGCGGTGCGCCTGTGGTGGGTGACCATGGGCGCAGTGGCCGTCGAG
GCCGGTGAGCGGGTGCAGGTCGCCACAGCGCCGGTATGGGGCCTCGGCCGGACAGTGATG
CAGGAGCGCCCGGAGCTCAGCTGCACTCTGGTGGATTTGGAGCCGGAGGCCGATGCAGCG
CGCTCAGCTGACGTTCTGTTGCGGGAGCTCGGTCGCGCTGACGACGAGACACAGGTGGCT
TTCCGTTCCGGAAAGCGCCGCGTAGCGCGGCTGGTCAAAGCGACGACCCCCGAAGGGCTC
CTGGTCCCTGACGCAGAGTCCTATCGACTGGAGGCTGGGCAGAAGGGCACATTGGACCAG
CTCCGCCTCGCGCCGGCACAGCGCCGGGCACCTGGCCCGGGCGAGGTCGAGATCAAGGTA
ACCGCCTCGGGGCTCAACTTCCGGACCGTCCTCGCTGTGCTGGGAATGTATCCGGGCGAC
GCCGGGCCGATGGGCGGAGATTGTGCCGGTGTCGCCACGGCGGTGGGCCAGGGGGTGCGC
CACGTCGCGGTCGGCGATGCTGTCATGACGCTGGGGACGTTGCATCGATTCGTCACGGTC
GACGCGCGGCTGGTGGTCCGGCAGCCTGCAGGGCTGACTCCCGCGCAGGCAGCTACGGTG
CCGGTCGCGTTCCTGACGGCCTGGCTCGCTCTGCACGACCTGGGGAATCTGCGGCGCGGC
GAGCGGGTGCTGATCCATGCTGCGGCCGGCGGTGTGGGCATGGCCGCGGTGCAAATCGCC
CGATGGATAGGGGCCGAGGTGTTCGCCACGGCGAGCCCGTCCAAGTGGGCAGCGGTTCAG
GCCATGGGCGTGCCGCGCACGCACATCGCCAGCTCGCGGACGCTGGAGTTTGCTGAGACG
TTCCGGCAGGTCACCGGCGGCCGGGGCGTGGACGTGGTGCTCAACGCGCTGGCCGGCGAG
TTCGTGGACGCGAGCCTGTCCCTGCTGTCGACGGGCGGGCGGTTCCTCGAGATGGGCAAG
ACCGACATACGGGATCGAGCCGCGGTCGCGGCGGCGCATCCCGGTGTTCGCTATCGGGTA
TTCGACATCCTGGAGCTCGCTCCGGATCGAACTCGAGAGATCCTCGAGCGCGTGGTCGAG
GGCTTTGCTGCGGGACATCTGCGCGCATTGCCGGTGCATGCGTTCGCGATCACCAAGGCC
GAGGCAGCGTTTCGGTTCATGGCGCAAGCGCGGCATCAGGGCAAGGTCGTGCTGCTGCCG
GCGCCCTCCGCAGCGCCCTTGGCGCCGACGGGCACCGTACTGCTGACCGGTGGGCTGGGA
GCGTTGGGGCTCCACGTGGCCCGCTGGCTCGCCCAGCAGGGCGTGCCGCACATGGTGCTC
ACAGGTCGGCGGGGCCTGGATACGCCGGGCGCTGCCAAAGCCGTCGCGGAGATCGAAGCG
CTCGGCGCTCGGGTGACGATCGCGGCGTCGGATGTCGCCGATCGGAATGCGCTGGAGGCT
GTGCTCCAGGCCATTCCGGCGGAGTGGCCGTTACAGGGCGTGATCCATGCAGCCGGAGCG
CTCGATGATGGTGTGCTTGATGAGCAGACCACCGACCGCTTCTCGCGGGTGCTGGCACCG
AAGGTGACTGGCGCCTGGAATCTGCATGAGCTCACGGCGGGCAACGATCTCGCTTTCTTC
GTGCTGTTCTCCTCCATGTCGGGGCTCTTGGGCTCGGCCGGGCAGTCCAACTATGCGGCG
GCCAACACCTTCCTCGACGCGCTGGCCGCGCATCGGCGGGCCGAAGGCCTGGCGGCGCAG
AGCCTCGCGTGGGGCCCATGGTCGGACGGAGGCATGGCAGCGGGGCTCAGCGCGGCGCTG
CAGGCGCGGCTCGCTCGGCATGGGATGGGAGCTCTGTCGCCGGCTCAGGGCACCGCGCTG
CTCGGGCAGGCGCTGGCTCGGCCGGAAACGCAGCTCGGGGCGATGTCGCTCGACGTGCGT
GCGGCAAGCCAAGCTTCGGGAGCGGCAGTGCCGCCTGTGTGGCGCGCGTTGGTGCGCGCG
GAGGCGCGCCATACGGCGGCTGGGGCGCAGGGGGCATTGGCCGCGCGTCTTGGGGCGCTG
CCCGAGGCGCGTCGCGCCGACGAGGTGCGCAAGGTCGTGCAGGCCGAGATCGCGCGCGTG
CTTTCATGGAGCGCCGCGAGCGCCGTGCCCGTCGATCGGCCGCTGTCGGACTTGGGCCTC
GACTCGCTCACGGCGGTGGAGCTGCGCAACGTGCTCGGCCAGCGGGTGGGTGCGACGCTG
CCGGCGACGCTGGCATTCGATCACCCGACGGTCGACGCGCTCACGCGCTGGCTGCTCGAT
AAGGTCCTGGCCGTGGCCGAGCCGAGCGTATCGTCCGCAAAGTCGTCGCCGCAGGTCGCC
CTCGACGAGCCCATTGCCATCATCGGCATCGGCTGCCGTTTCCCAGGCGGCGTGGCCGAT
CCGGAGTCGTTTTGGCGGCTGCTCGAAGAGGGCAGCGATGCCGTCGTCGAGGTGCCGCAT
GAGCGATGGGACATCGACGCGTTCTATGATCCGGATCCGGATGTGCGCGGCAAGATGACG
ACACGCTTTGGCGGCTTCCTGTCCGATATCGACCGGTTCGATCCGGCCTTCTTCGGCATC
TCGCCGCGCGAAGCGACGACCATGGATCCGCAGCAGCGGCTGCTCCTGGAGACGAGCTGG
GAGGCGTTCGAGCGCGCCGGGATTTTGCCCGAGCGGCTGATGGGCAGCGATACCGGCGTG
TTCGTGGGGCTCTTCTACCAGGAGTACGCTGCGCTCGCCGGCGGCATCGAGGCGTTCGAT
GGCTATCTAGGCACCGGCACCACGGCCAGCGTCGCCTCGGGCAGGATCTCTTATGTGCTC
GGGCTAAAGGGGCCGAGCCTGACGGTGGACACCGCGTGCTCCTCGTCGCTGGTCGCGGTG
CACCTGGCCTGCCAGGCGCTGCGGCGGGGCGAGTGTTCGGTGGCGCTGGCCGGCGGCGTG
GCGCTGATGCTCACGCCGGCGACGTTCGTGGAGTTCAGCCGGCTGCGAGGCCTGGCTCCC
GACGGACGGTGCAAGAGCTTCTCGGCCGCAGCCGACGGCGTGGGGTGGAGCGAAGGCTGC
GCCATGCTCCTGCTCAAACCGCTTCGCGATGCGCAGCGCGATGGGGATCCGATCCTGGCG
GTGATCCGCGGCACCGCGGTGAACCAGGATGGGCGCAGCAACGGGCTGACGGCGCCCAAC
GGGTCGTCGCAGCAAGAGGTGATCCGTCGGGCCCTGGAGCAGGCGGGGCTGGCTCCGGCG
GACGTCAGCTACGTCGAGTGCCACGGCACCGGCACGACGTTGGGCGACCCCATCGAAGTG
CAGGCCCTGGGCGCCGTGCTGGCACAGGGGCGACCCTCGGACCGGCCGCTCGTGATCGGG
TCGGTGAAGTCCAATATCGGACATACGCAGGCTGCGGCGGGCGTGGCCGGTGTCATCAAG
GTGGCGCTGGCGCTCGAGCGCGGGCTTATCCCGAGGAGCCTGCATTTCGACGCGCCCAAT
CCGCACATTCCGTGGTCGGAGCTCGCCGTGCAGGTGGCCGCCAAACCCGTCGAATGGACG
AGAAACGGCGTGCCGCGACGAGCCGGGGTGAGCTCGTTTGGCGTCAGCGGGACCAACGCG
CACGTGGTGCTGGAGGAGGCGCCAGCGGCGGCGTTCGCGCCCGCGGCGGCGCGTTCAGCG
GAGCTTTTCGTGCTGTCGGCGAAGAGCGCCGCGGCGCTGGACGCGCAGGCGGCGCGGCTT
TCGGCGCACGTCGTTGCGCACCCGGAGCTCGGCCTCGGCGACCTGGCGTTCAGCCTGGCG
ACGACCCGCAGCCCGATGACGTACCGGCTCGCGGTGGCGGCGACCTCGCGCGAGGCGCTG
TCTGCCGCGCTCGACACAGCGGCGCAGGGGCAGGCGCCGCCCGCAGCGGCTCGCGGCCAC
GCTTCCACAGGCAGCGCCCCAAAGGTGGTTTTCGTCTTTCCTGGCCAGGGCTCCCAGTGG
CTGGGCATGGGCCAAAAGCTCCTCTCGGAGGAGCCCGTCTTCCGCGACGCGCTCTCGGCG
TGTGACCGAGCGATTCAGGCCGAAGCCGGCTGGTCGCTGCTCGCCGAGCTCGCGGCCGAT
GAGACCACCTCGCAGCTCGGCCGCATCGACGTGGTGCAGCCGGCGCTGTTCGCGATCGAG
GTCGCGCTGTCGGCGCTGTGGCGGTCGTGGGGCGTCGAGCCGGATGCAGTGGTAGGCCAC
AGCATGGGCGAAGTGGCGGCCGCGCACGTCGCCGGCGCCCTGTCGCTCGAGGATGCTGTA
GCGATCATCTGCCGGCGCAGCCTGCTGCTGCGGCGGATCAGCGGCCAAGGCGAGATGGCG
GTCGTCGAGCTTTCCCTGGCCGAGGCCGAGGCAGCGCTCCTGGGCTACGAAGACCGGCTC
AGCGTGGCGGTGAGCAACAGCCCGCGCTCGACGGTGCTGGCGGGCGAGCCGGCAGCGCTC
GCAGAGGTGCTGGCGATCCTTGCGGCAAAGGGGGTGTTCTGCCGTCGAGTCAAGGTGGAC
GTCGCCAGCCACAGCCCACAGATCGACCCGCTGCGCGACGAGCTATTGGCAGCATTGGGC
GAGCTCGAGCCGCGACAAGCGACCGTGTCGATGCGCTCGACGGTGACGAGCACGATCATG
GCGGGCCCGGAGCTCGTGGCGAGCTACTGGGCGGACAACGTTCGACAGCCGGTGCGCTTC
GCCGAAGCGGTGCAATCGTTGATGGAAGACGGTCATGGGCTGTTCGTGGAGATGAGCCCG
CATCCGATCCTGACGACATCGGTCGAGGAGATCCGACGGGCGACGAAGCGGGAGGGAGTC
GCGGTGGGCTCGTTGCGGCGTGGACAGGACGAGCGCCTGTCCATGTTGGAGGCGCTGGGA
GCGCTCTGGGTACACGGCCAGGCGGTGGGCTGGGAGCGGCTGTTCTCCGCGGGCGGCGCG
GGCCTCCGTCGCGTGCCGCTGCCGACCTATCCCTGGCAGCGCGAGCGGTACTGGGTCGAT
GCGCCGACCGGCGGCGCGGCGGGCGGCAGCCGCTTTGCTCATGCGGGCAGTCACCCGCTC
CTGGGTGAAATGCAGACCCTGTCGACCCAGAGGAGCACGCGCGTGTGGGAGACGACGCTG
GATCTCAAACGGCTGCCGTGGCTCGGCGATCACCGGGTGCAGGGGGCGGTCGTGTTCCCG
GGCGCGGCGTACCTGGAGATGGCGCTTTCGTCCGGGGCCGAGGCCTTGGGTGACGGTCCG
CTCCAGGTCAGCGATGTGGTGCTCGCCGAGGCGCTGGCCTTCGCGGATGATACGCCGGCG
GCGGTGCAGGTCATGGCGACCGAGGAGCGACCAGGCCGCCTGCAATTCCACGTTGCGAGC
CGGGTGCCGGGCCACGGCGGTGCTGCCTTTCGAAGCCATGCCCGCGGGGTGCTGCGCCAG
ATCGAGCGCGCCGAGGTCCCGGCGAGGCTGGATCTGGCCGCGCTTCGTGCCCGGCTTCAG
GCCAGCGCACCCGCTGCGGCTACCTATGCGGCGCTGGCCGAGATGGGGCTCGAGTACGGC
CCAGCGTTCCAGGGGCTTGTCGAGCTGTGGCGGGGGGAGGGCGAGGCGCTGGGACGTGTG
CGGCTCCCCGAGGCCGCCGGCTCCCCAGCCGCGTGCCGGCTCCACCCCGCGCTCTTGGAT
GCGTGCTTCCACGTGAGCAGCGCCTTCGCTGACCGCGGCGAGGCGACGCCATGGGTACCC
GTGGAAATCGGCTCGCTGCGGTGGTTCCAGCGGCCGTCGGGGGAGCTGTGGTGTCATGCG
CGGAGTGTGAGCCACGGAAAGCCAACACCCGACCGGCGGAGTACCGACTTCTGGGTGGTC
GACAGCACGGGCGCGATCGTCGCCGAGATCTCCGGGCTCGTGGCGCAGCGGCTCGCGGGA
GGTGTACGCCGGCGCGAAGAAGACGACTGGTTCATGGAGCCGGCTTGGGAACCGACCGCG
GTCCCCGGATCCGAGGTCATGGCGGGCCGGTGGCTGCTCATCGGCTCGGGCGGCGGGCTC
GGCGCTGCGCTCCACTCGGCGCTGACGGAAGCTGGCCATTCCGTCGTCCACGCGACAGGG
CGCGGCACGAGCGCCGCCGGGTTGCAGGCACTCTTGACGGCGTCCTTCGACGGCCAGGCC
CCGACGTCGGTGGTGCACCTCGGCAGCCTCGATGAGCGTGGCGTGCTCGACGCGGATGCC
CCCTTCGACGCCGATGCGCTTGAGGAGTCGCTGGTGCGCGGCTGCGACAGCGTGCTCTGG
ACCGTGCAGGCCGTGGCCGGGGCGGGCTTCCGAGATCCTCCGCGGTTGTGGCTCGTGACA
CGCGGCGCTCAGGCCATCGGCGCCGGCGACGTCTCTGTGGCGCAAGCGCCGCTCCTGGGG
CTGGGCCGCGTTATCGCCTTGGAGCACGCCGAGCTGCGCTGCGCTCGGATCGACCTCGAT
CCAGCGCGGCGCGACGGAGAAGTCGATGAGCTGCTTGCCGAGCTGTTGGCCGACGACGCC
GAGGAGGAAGTCGCGTTTCGCGGCGGTGAGCGGCGCGTGGCCCGGCTCGTCCGAAGGCTG
CCCGAGACCGACTGCCGAGAGAAAATCGAGCCCGCGGAAGGCCGGCCGTTCCGGCTGGAG
ATCGATGGGTCCGGCGTGCTCGACGACCTGGTGCTCCGAGCCACGGAGCGGCGCCCTCCT
GGCCCGGGCGAGGTCGAGATCGCCGTCGAGGCGGCGGGGCTCAACTTTCTCGACGTGATG
AGGGCCATGGGGATCTACCCTGGGCCCGGGGACGGTCCGGTTGCGCTGGGCGCCGAGTGC
TCCGGCCGAATTGTCGCGATGGGCGAAGGTGTCGAGAGCCTTCGTATCGGCCAGGACGTC
GTGGCCGTCGCGCCCTTCAGTTTCGGCACCCACGTCACCATCGACGCCCGGATGCTCGCA
CCTCGCCCCGCGGCGCTGACGGCCGCGCAGGCAGCCGCGCTGCCCGTCGCATTCATGACG
GCCTGGTACGGTCTCGTCCATCTGGGGAGGCTCCGGGCCGGCGAGCGCGTGCTCATCCAC
TCGGCGACGGGGGGCACCGGGCTCGCTGCTGTGCAGATCGCCCGCCACCTCGGCGCGGAG
ATATTTGCGACCGCTGGTACACCGGAGAAGCGGGCGTGGCTGCGCGAGCAGGGGATCGCG
CACGTGATGGACTCGCGGTCGCTGGACTTCGCCGAGCAAGTGCTGGCCGCGACGAAGGGC
GAGGGGGTCGACGTCGTGTTGAACTCGCTGTCTGGCGCCGCGATCGACGCGAGCCTTTCG
ACCCTCGTGCCGGACGGCCGCTTCATCGAGCTCGGCAAGACGGACATCTATGCAGATCGC
TCGCTGGGGCTCGCTCACTTCAGGAAGAGCCTGTCCTACAGCGCCGTCGATCTTGCGGGC
TTGGCCGTGCGTCGGCCCGAGCGCGTCGCAGCGCTGCTGGCGGAGGTGGTGGACCTGCTC
GCACGGGGAGCGCTGCAGCCGCTTCCGGTAGAGATCTTCCCCCTCTCGCGGGCCGCGGAC
GCGTTCCGGAAAATGGCGCAAGCGCAGCATCTCGGGAAGCTCGTGCTCGCGCTGGAGGAC
CCGGACGTGCGGATCCGCGTTCCGGGCGAATCCGGCGTCGCCATCCGCGCGGACGGCGCC
TACCTCGTGACCGGCGGTCTGGGGGGGCTCGGTCTGAGCGTGGCTGGATGGCTGGCCGAG
CAGGGGGCTGGGCATCTGGTGCTGGTGGGCCGCTCCGGCGCGGTGAGCGCGGAGCAGCAG
ACGGCTGTCGCCGCGCTCGAGGCGCACGGCGCGCGTGTCACGGTAGCGAGGGCAGACGTC
GCCGATCGGGCGCAGATGGAGCGGATCCTCCGCGAGGTTACCGCGTCGGGGATGCCGCTC
CGCGGCGTCGTTCATGCGGCCGGAATCCTGGACGACGGGCTGCTGATGCAGCAAACCCCC
GCGCGGTTCCGCGCGGTCATGGCGCCCAAGGTCCGAGGGGCCTTGCACCTGCATGCGTTG
ACACGCGAAGCGCCGCTCTCCTTCTTCGTGCTGTACGCTTCGGGAGCAGGGCTCTTGGGC
TCGCCGGGCCAGGGCAACTACGCCGCGGCCAACACGTTCCTCGACGCACTGGCACACCAC
CGGAGGGCGCAGGGGCTGCCAGCATTGAGCATCGACTGGGGCCTGTTCGCGGACGTGGGT
TTGGCCGCCGGGCAGCAAAATCGCGGCGCACGGCTGGTCACCCGCGGGACGCGGAGCCTC
ACCCCCGACGAAGGGCTGTGGGCGCTCGAGCGCCTGCTCGACGGCGATCGCACCCAGGCC
GGGGTCATGCCGTTCGACGTGCGGCAGTGGGTGGAGTTCTACCCGGCGGCGGCATCTTCG
CGGAGGTTGTCGCGGCTCATGACGGCACGGCGCGTGGCTTCCGGTCGGCTCGCCGGGGAT
CGGGACCTGCTCGAACGGCTCGCCACCGCCGAGGCGGGCGCGCGGGCAGGGATGCTGCAG
GAGGTCGTGCGCGCGCAGGTCTCGCAGGTGCTGCGCCTCTCCGAAGGCAAGCTCGACGTG
GATGCGCCGCTCACGAGCCTGGGAATGGACTCGCTGATGGGGCTAGAGCTGCGCAACCGC
ATCGAGGCCGTGCTCGGCATCACCATGCCGGCGACCCTGCTGTGGACCTACCCCACGGTG
GCAGCGCTGAGTGCGCATCTGGCTTCTCATGTCGTCTCTACGGGGGATGGGGAATCCGCG
CGCCCGCCGGATACAGGGAGCGTGGCTCCAACGACCCACGAAGTCGCTTCGCTCGACGAA
GACGGGTTGTTCGCGTTGATTGATGAGTCACTCGCGCGCGCGGGAAAGAGGTGA
[3] KS39..408
[3] AT563..848
[3] malonyl-CoA756..760
[3] KR1149..1338
[3] ACP1433..1503
[4] KS1525..1898
[4] AT2056..2341
[4] malonyl-CoA for Epothilone A methylmalonyl-CoA for Epothilone B2249..2253
[4] KR2647..2836
[4] ACP2932..3002
[5] KS3023..3397
[5] AT3555..3861
[5] malonyl-CoA3748..3752
[5] DH3917..4083
[5] ER4416..4718
[5] KR4731..4910
[5] ACP5005..5079
[6] KS5102..5477
[6] AT5630..5948
[6] methylmalonyl-CoA not conserved YASHS(Y->V)5821..5825
[6] DH5998..6166
[6] ER6525..6836
[6] KR6859..7039
[6] ACP7139..7208
[3] KS115..1224
[3] AT1687..2544
[3] malonyl-CoA2266..2280
[3] KR3445..4014
[3] ACP4297..4509
[4] KS4573..5694
[4] AT6166..7023
[4] malonyl-CoA for Epothilone A methylmalonyl-CoA for Epothilone B6745..6759
[4] KR7939..8508
[4] ACP8794..9006
[5] KS9067..10191
[5] AT10663..11583
[5] malonyl-CoA11242..11256
[5] DH11749..12249
[5] ER13246..14154
[5] KR14191..14730
[5] ACP15013..15237
[6] KS15304..16431
[6] AT16888..17844
[6] methylmalonyl-CoA not conserved YASHS(Y->V)17461..17475
[6] DH17992..18498
[6] ER19573..20508
[6] KR20575..21117
[6] ACP21415..21624

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [560-685]  G3DSA:3.40.366.10 [755-863]  G3DSA:3.40.366.10 [2053-2178]  G3DSA:3.40.366.10 [2248-2356]  G3DSA:3.40.366.10 [3552-3677]  G3DSA:3.40.366.10 [3747-3854]  G3DSA:3.40.366.10 [5624-5753]  G3DSA:3.40.366.10 [5821-5938]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [4540-4561]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [7166-7181]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1436-1502]  2e-10 PF00550 [2936-3001]  2.9e-12 PF00550 [5013-5078]  6.80000000000001e-10 PF00550 [7142-7207]  1.3e-12 PF00550
PF00550   PP-binding
 [1433-1503]  PS50075 [2932-3002]  PS50075 [5005-5079]  PS50075 [7139-7208]  PS50075
PS50075   ACP_DOMAIN
 [1430-1505]  1.10000000000001e-74 G3DSA:1.10.1200.10 [2932-3001]  1.10000000000001e-74 G3DSA:1.10.1200.10 [5007-5081]  1.10000000000001e-74 G3DSA:1.10.1200.10 [7139-7211]  1.10000000000001e-74 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1426-1541]  4.40000933643891e-26 SSF47336 [2925-3040]  1.10000150671642e-23 SSF47336 [5002-5119]  5.49999338756182e-24 SSF47336 [7132-7211]  1.10000150671642e-20 SSF47336
SSF47336   ACP_like
IPR011032 GroES-like (Domain)
 [4407-4547]  4.30000170645867e-30 SSF50129 [6516-6662]  1.79999754022375e-33 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [4551-4642]  5.20000000000001e-17 PF00107 [6665-6797]  2.3e-23 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [6542-6604]  2.6e-08 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1149-1337]  8.1e-69 PF08659 [2647-2835]  2.30000000000004e-67 PF08659 [4731-4909]  1.99999999999999e-69 PF08659 [6859-7038]  3.99999999999998e-72 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [39-283]  7.5e-88 PF00109 [1525-1776]  3.19999999999996e-87 PF00109 [3023-3275]  1.60000000000002e-92 PF00109 [5102-5351]  1.79999999999997e-99 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-408]  5.00000000000001e-40 PF02801 [1784-1898]  8.70000000000003e-38 PF02801 [3283-3397]  4.70000000000003e-39 PF02801 [5359-5477]  7.89999999999997e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [563-848]  1e-62 PF00698 [2056-2341]  2.80000000000001e-62 PF00698 [3555-3861]  9.60000000000003e-63 PF00698 [5630-5948]  6.40000000000004e-101 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [559-872]  1.79999754022378e-74 SSF52151 [2052-2365]  8.60006330213929e-74 SSF52151 [3551-3864]  3.99998544139406e-76 SSF52151 [5628-5930]  4.20003460493095e-71 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [690-755]  1.49999977583352e-16 SSF55048 [2183-2248]  1.49999977583352e-16 SSF55048 [3682-3747]  8.39999858592306e-15 SSF55048 [5755-5820]  3.60000433965927e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [41-295]  G3DSA:3.40.47.10 [296-460]  G3DSA:3.40.47.10 [1524-1787]  G3DSA:3.40.47.10 [1788-1953]  G3DSA:3.40.47.10 [3023-3286]  G3DSA:3.40.47.10 [3287-3453]  G3DSA:3.40.47.10 [5105-5363]  G3DSA:3.40.47.10 [5364-5528]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [31-405]  5.29997329885557e-97 SSF53901 [1517-1890]  9.20006495413779e-99 SSF53901 [3016-3397]  9.69997533354407e-102 SSF53901 [5102-5475]  1.50000965748778e-109 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1150-1344]  G3DSA:3.40.50.720 [2648-2842]  G3DSA:3.40.50.720 [4548-4643]  5.79999999999997e-45 G3DSA:3.40.50.720 [4731-4946]  G3DSA:3.40.50.720 [6617-6811]  1.29999999999998e-111 G3DSA:3.40.50.720 [6860-7064]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [196-212]  PS00606 [1689-1705]  PS00606 [3188-3204]  PS00606 [5264-5280]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [564-862]  2.19999900980707e-119 SM00827 [2057-2355]  7.90003079443025e-116 SM00827 [3556-3854]  1.19999063421924e-120 SM00827 [5632-5929]  2.7000136937899e-120 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1434-1506]  1.99999636034521e-26 SM00823 [2933-3005]  1.89999859865865e-23 SM00823 [5010-5082]  1.60000240695997e-26 SM00823 [7140-7211]  1.20000117458134e-29 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [3917-4083]  1.10000150671642e-25 SM00826 [5998-6166]  1.79999754022375e-51 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [41-461]  SM00825 [1527-1954]  SM00825 [3026-3453]  SM00825 [5105-5529]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1149-1338]  1.49999648196323e-62 SM00822 [2647-2836]  1.20000117458134e-56 SM00822 [4731-4910]  8.79996401030984e-66 SM00822 [6859-7039]  1.40000506907309e-63 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [4416-4718]  SM00829 [6525-6836]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit