close all open/close all

CDS information : Epoth_00120


close this sectionLocation

Organism
StrainSo ce90
Entry nameEpothilone
Contig
Start / Stop / Direction62,369 / 63,628 / + [in whole cluster]
62,369 / 63,628 / + [in contig]
Location62369..63628 [in whole cluster]
62369..63628 [in contig]
TypeCDS
Length1,260 bp (419 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative epoxidase
putative cytochrome P450
Product (GenBank)cytochrome P450
Gene
Gene (GenBank)epoF
EC number
Keyword
Note
Note (GenBank)
  • EPOS F
Reference
ACC
PmId
[10662695] The biosynthetic gene cluster for the microtubule-stabilizing agents epothilones A and B from Sorangium cellulosum So ce90. (Chem Biol. , 2000)
Related Reference
ACC
Q9KIZ4
NITE
Epoth2_00090*
PmId
[10831849] Isolation and characterization of the epothilone biosynthetic gene cluster from Sorangium cellulosum. (Gene. , 2000)
[10649995] Cloning and heterologous expression of the epothilone gene cluster. (Science. , 2000)
[12933799] Crystal structures of epothilone D-bound, epothilone B-bound, and substrate-free forms of cytochrome P450epoK. (J Biol Chem. , 2003)
[26445909] Highly Efficient CYP167A1 (EpoK) dependent Epothilone B Formation and Production of 7-Ketone Epothilone D as a New Epothilone Derivative. (Sci Rep. , 2015)

close this sectionSequence

selected fasta
>putative epoxidase [cytochrome P450]
MTQEQANQSETKPAFDFKPFAPGYAEDPFPAIERLREATPIFYWDEGRSWVLTRYHDVSA
VFRDERFAVSREEWESSAEYSSAIPELSDMKKYGLFGLPPEDHARVRKLVNPSFTSRAID
LLRAEIQRTVDQLLDARSGQEEFDVVRDYAEGIPMRAISALLKVPAECDEKFRRFGSATA
RALGVGLVPQVDEETKTLVASVTEGLALLHDVLDERRRNPLENDVLTMLLQAEADGSRLS
TKELVALVGAIIAAGTDTTIYLIAFAVLNLLRSPEALELVKAEPGLMRNALDEVLRFDNI
LRIGTVRFARQDLEYCGASIKKGEMVFLLIPSALRDGTVFSRPDVFDVRRDTGASLAYGR
GPHVCPGVSLARLEAEIAVGTIFRRFPEMKLKETPVFGYHPAFRNIESLNVILKPSKAG
selected fasta
>putative epoxidase [cytochrome P450]
ATGACACAGGAGCAAGCGAATCAGAGTGAGACGAAGCCTGCTTTCGACTTCAAGCCGTTC
GCGCCTGGGTACGCGGAGGACCCGTTCCCCGCGATCGAGCGCCTGAGAGAGGCAACCCCC
ATCTTCTACTGGGATGAAGGCCGCTCCTGGGTCCTCACCCGATACCACGACGTGTCGGCG
GTGTTCCGCGACGAACGCTTCGCGGTCAGTCGAGAAGAGTGGGAATCGAGCGCGGAGTAC
TCGTCGGCCATTCCCGAGCTCAGCGATATGAAGAAGTACGGATTGTTCGGGCTGCCGCCG
GAGGATCACGCTCGGGTCCGCAAGCTCGTCAACCCGTCGTTTACGTCACGCGCCATCGAC
CTGCTGCGCGCCGAAATACAGCGCACCGTCGACCAGCTGCTCGATGCTCGCTCCGGACAA
GAGGAGTTCGACGTTGTGCGGGATTACGCGGAGGGAATCCCGATGCGCGCGATCAGCGCT
CTGTTGAAGGTTCCGGCCGAGTGTGACGAGAAGTTCCGTCGCTTCGGCTCGGCGACTGCG
CGCGCGCTCGGCGTGGGTTTGGTGCCCCAGGTCGATGAGGAGACCAAGACCCTGGTCGCG
TCCGTCACCGAGGGGCTCGCGCTGCTCCATGACGTCCTCGATGAGCGGCGCAGGAACCCG
CTCGAAAATGACGTCTTGACGATGCTGCTTCAGGCCGAGGCCGACGGCAGCAGGCTGAGC
ACGAAGGAGCTGGTCGCGCTCGTGGGTGCGATTATCGCTGCTGGCACCGATACCACGATC
TACCTTATCGCGTTCGCTGTGCTCAACCTGCTGCGGTCGCCCGAGGCGCTCGAGCTGGTG
AAGGCCGAGCCCGGGCTCATGAGGAACGCGCTCGATGAGGTGCTCCGCTTCGACAATATC
CTCAGAATAGGAACTGTGCGTTTCGCCAGGCAGGACCTGGAGTACTGCGGGGCATCGATC
AAGAAAGGGGAGATGGTCTTTCTCCTGATCCCGAGCGCCCTGAGAGATGGGACTGTATTC
TCCAGGCCAGACGTGTTTGATGTGCGACGGGACACGGGCGCGAGCCTCGCGTACGGTAGA
GGCCCCCATGTCTGCCCCGGGGTGTCCCTTGCTCGCCTCGAGGCGGAGATCGCCGTGGGC
ACCATCTTCCGTAGGTTCCCCGAGATGAAGCTGAAAGAAACTCCCGTGTTTGGATACCAC
CCCGCGTTCCGGAACATCGAATCACTCAACGTCATCTTGAAGCCCTCCAAAGCTGGATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [254-271]  5.9e-06 PR00385 [289-300]  5.9e-06 PR00385 [356-365]  5.9e-06 PR00385 [365-376]  5.9e-06 PR00385
PR00385   P450
 [49-283]  1.9e-09 PF00067 [287-386]  3.3e-16 PF00067
PF00067   p450
 [17-415]  5.3e-94 G3DSA:1.10.630.10
G3DSA:1.10.630.10   no description
 [17-415]  5.8e-84 SSF48264
SSF48264   Cytochrome P450
IPR002397 Cytochrome P450, B-class (Family)
 [98-109]  1e-31 PR00359 [144-160]  1e-31 PR00359 [161-176]  1e-31 PR00359 [207-229]  1e-31 PR00359 [289-300]  1e-31 PR00359 [307-334]  1e-31 PR00359 [335-350]  1e-31 PR00359 [356-365]  1e-31 PR00359 [365-376]  1e-31 PR00359
PR00359   BP450
SignalP
 [1-38]  0.02 Signal
Eukaryota   
TMHMM
 [244-266]  Transmembrane (i-o)
Transmembrane 1