close all open/close all

CDS information : Epoth_00130


close this sectionLocation

Organism
StrainSo ce90
Entry nameEpothilone
Contig
Start / Stop / Direction63,779 / 64,333 / + [in whole cluster]
63,779 / 64,333 / + [in contig]
Location63779..64333 [in whole cluster]
63779..64333 [in contig]
TypeCDS
Length555 bp (184 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF6
Reference
ACC
PmId
[10662695] The biosynthetic gene cluster for the microtubule-stabilizing agents epothilones A and B from Sorangium cellulosum So ce90. (Chem Biol. , 2000)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MTSEEVPGAALGAQSSLVRAQHAARHVRPCTRAEEPPALMHGLTERQVLLSLVALALVLL
TARAFGELARRLRQPEVLGELFGGVVLGPSVVGALAPGFHRVLFQDPAVGVVLSGISWIG
ALVLLLMAGIEVDVSILRKEARPGALSALGAIAPPLRTPGPLVQRMQGAFTWDLDVSPRR
SAQA
selected fasta
>hypothetical protein [unknown]
GTGACGTCGGAAGAAGTGCCGGGCGCCGCCCTGGGAGCGCAAAGCTCGCTCGTTCGCGCT
CAGCACGCCGCTCGTCATGTCCGGCCCTGCACCCGCGCCGAGGAGCCGCCCGCCCTGATG
CACGGCCTCACCGAGCGGCAGGTTCTGCTCTCGCTCGTCGCCCTCGCGCTCGTCCTCCTG
ACCGCGCGCGCCTTCGGCGAGCTCGCGCGGCGGCTGCGCCAGCCCGAGGTGCTCGGCGAG
CTCTTCGGCGGCGTGGTGCTGGGCCCGTCCGTCGTCGGCGCGCTCGCTCCTGGGTTCCAT
CGAGTCCTCTTCCAGGATCCGGCGGTCGGGGTCGTGCTCTCCGGCATCTCCTGGATAGGC
GCGCTCGTCCTGCTGCTCATGGCGGGTATCGAGGTCGATGTGAGCATCCTGCGCAAGGAG
GCGCGCCCCGGGGCGCTCTCGGCGCTCGGCGCGATCGCGCCCCCGCTGCGCACGCCGGGG
CCGCTGGTGCAGCGCATGCAGGGCGCGTTCACGTGGGATCTCGACGTCTCGCCGCGACGC
TCTGCGCAAGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006153 Cation/H+ exchanger (Domain)
 [55-152]  1.4e-10 PF00999
PF00999   Na_H_Exchanger
SignalP
 [1-64]  0.208 Signal
Eukaryota   
 [1-33]  0.104 Signal
Bacteria, Gram-negative   
TMHMM
 [47-66]  Transmembrane (o-i) [78-100]  Transmembrane (i-o) [110-132]  Transmembrane (o-i)
Transmembrane 3