close all open/close all

CDS information : Epoth_00190


close this sectionLocation

Organism
StrainSo ce90
Entry nameEpothilone
Contig
Start / Stop / Direction66,338 / 65,871 / - [in whole cluster]
66,338 / 65,871 / - [in contig]
Locationcomplement(65871..66338) [in whole cluster]
complement(65871..66338) [in contig]
TypeCDS
Length468 bp (155 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF12
Reference
ACC
PmId
[10662695] The biosynthetic gene cluster for the microtubule-stabilizing agents epothilones A and B from Sorangium cellulosum So ce90. (Chem Biol. , 2000)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MDPRARREKRPSLLDSRGRQPKRSQQGGHMEKPIGRTRWAIAEGYIPGRSNGPEPQMTSH
ETACLLNASDRDAQVAITVYFSDRDPAGPYRVTVPARRTRHVRFNDLTEPEPIPRDTDYA
SVIESDVPIVVQHTRLDSRQAENALISTIAYTDRE
selected fasta
>hypothetical protein [unknown]
ATGGATCCCCGAGCGCGTCGGGAGAAGAGGCCGTCGCTCCTGGACAGCAGAGGGAGGCAG
CCAAAGAGGAGCCAGCAGGGAGGACATATGGAGAAGCCGATCGGGCGGACGCGCTGGGCA
ATCGCAGAGGGCTACATCCCAGGCCGGAGCAACGGACCCGAGCCGCAGATGACGAGCCAT
GAGACGGCCTGCCTGTTGAATGCGTCGGACCGGGACGCGCAGGTCGCCATCACCGTCTAC
TTCAGCGACCGCGACCCCGCCGGGCCGTACCGGGTGACCGTCCCAGCGAGGCGCACCCGG
CACGTCCGGTTCAACGATCTGACCGAACCCGAGCCGATCCCGCGCGATACGGACTATGCC
AGCGTGATCGAATCGGACGTTCCCATTGTCGTGCAGCATACCCGGCTCGACTCGCGTCAG
GCGGAGAACGCGCTGATCAGCACGATCGCCTACACGGACCGGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009794 Protein of unknown function DUF1362 (Family)
 [32-155]  2.30000440726534e-55 SSF89232
SSF89232   DUF1362
 [34-152]  2.4e-58 PF07100
PF07100   ASRT
 [15-154]  4.39999999999997e-63 G3DSA:2.60.290.11
G3DSA:2.60.290.11   DUF1362
 [14-155]  2.19999900980707e-105 PIRSF008711
PIRSF008711   UCP008711
SignalP No significant hit
TMHMM No significant hit