close all open/close all

CDS information : Epoth_00200


close this sectionLocation

Organism
StrainSo ce90
Entry nameEpothilone
Contig
Start / Stop / Direction66,667 / 67,137 / + [in whole cluster]
66,667 / 67,137 / + [in contig]
Location66667..67137 [in whole cluster]
66667..67137 [in contig]
TypeCDS
Length471 bp (156 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF13
Reference
ACC
PmId
[10662695] The biosynthetic gene cluster for the microtubule-stabilizing agents epothilones A and B from Sorangium cellulosum So ce90. (Chem Biol. , 2000)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MRRSRWQMKHVDTGRRVGRRIGLTLGLLASMALAGCGGPSEKIVQGTRLAPGADAHVAAD
VDPDAATTRLAVDVVHLSPPERIEAGSERFVVWQRPSSESPWQRVGVLDYNAASRRGKLA
ETTVPHANFELLITVEKQSSPQSPSSAAVIGPTSVG
selected fasta
>hypothetical protein [unknown]
GTGAGGCGATCGAGGTGGCAGATGAAACACGTTGACACGGGCCGACGAGTCGGCCGCCGG
ATAGGGCTCACGCTCGGTCTCCTCGCGAGCATGGCGCTCGCCGGCTGTGGCGGCCCGAGC
GAGAAAATCGTGCAGGGCACGCGGCTCGCGCCCGGCGCCGATGCGCACGTCGCCGCCGAC
GTCGACCCCGACGCCGCGACCACGCGGCTGGCGGTGGACGTCGTTCACCTCTCGCCGCCC
GAGCGCATCGAGGCCGGCAGCGAGCGGTTCGTCGTCTGGCAGCGTCCGAGCTCCGAGTCC
CCGTGGCAACGGGTCGGAGTGCTCGACTACAACGCTGCCAGCCGAAGAGGCAAGCTGGCC
GAGACGACCGTGCCGCATGCCAACTTCGAGCTGCTCATCACCGTCGAGAAGCAGAGCAGC
CCTCAGTCTCCATCTTCTGCCGCCGTCATCGGGCCGACGTCCGTCGGGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-59]  0.995 Signal
Bacteria, Gram-positive   
 [1-34]  0.852 Signal
Eukaryota   
 [1-35]  0.949 Signal
Bacteria, Gram-negative   
TMHMM
 [21-38]  Transmembrane (i-o)
Transmembrane 1