close all open/close all

CDS information : Epoth_00210


close this sectionLocation

Organism
StrainSo ce90
Entry nameEpothilone
Contig
Start / Stop / Direction67,334 / 68,251 / + [in whole cluster]
67,334 / 68,251 / + [in contig]
Location67334..68251 [in whole cluster]
67334..68251 [in contig]
TypeCDS
Length918 bp (305 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)putative transport protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF14; similar to Streptomyces lividans hypothetical protein and to cation efflux system proteins
Reference
ACC
PmId
[10662695] The biosynthetic gene cluster for the microtubule-stabilizing agents epothilones A and B from Sorangium cellulosum So ce90. (Chem Biol. , 2000)
Related Reference
ACC
Q5IRJ6
PmId
[15988012] GAC63, a GRIP1-dependent nuclear receptor coactivator. (Mol Cell Biol. , 2005)
[17344318] Role of GAC63 in transcriptional activation mediated by beta-catenin. (Nucleic Acids Res. , 2007)
Family/Domain
FD
IPR002524

close this sectionSequence

selected fasta
>putative transporter [putative transport protein]
MEKESRIAIYGAIAANVAIAAVKFIAAAVTGSSAMLSEGVHSLVDTADGLLLLLGKHRSA
RPPDAEHPFGHGKELYFWTLIVAIMIFAAGGGVSIYEGILHLLHPRQIEDPTWNYVVLGA
AAVFEGTSLIISIHEFKKKDGQGYLAAMRSSKDPTTFTIVLEDSAALAGLTIAFLGVWLG
HRLGNPYLDGAASIGIGLVLAAVAVFLASQSRGLLVGESADRELLAAIRALASADPGVSA
VGRPLTMHFGPHEVLVVLRIEFDAALTASGVAEAIERIETRIRSERPDVKHIYVEARSLH
QRARA
selected fasta
>putative transporter [putative transport protein]
ATGGAGAAAGAATCGAGGATCGCGATCTACGGCGCCATCGCAGCCAACGTGGCGATCGCG
GCGGTCAAGTTCATCGCCGCCGCCGTGACCGGCAGCTCGGCGATGCTCTCCGAGGGCGTG
CACTCCCTCGTCGATACTGCAGACGGGCTCCTCCTCCTGCTCGGCAAGCACCGGAGCGCA
CGCCCGCCCGACGCCGAGCATCCGTTCGGCCACGGCAAGGAGCTCTATTTCTGGACGCTG
ATCGTCGCCATCATGATCTTCGCCGCGGGCGGCGGCGTCTCGATCTACGAAGGGATCTTG
CACCTCTTGCACCCGCGCCAGATCGAGGATCCGACGTGGAACTACGTCGTCCTCGGCGCA
GCGGCCGTCTTCGAGGGGACGTCGCTCATCATCTCGATCCACGAGTTCAAGAAGAAGGAC
GGACAGGGCTACCTCGCGGCGATGCGGTCCAGCAAGGACCCGACGACGTTCACGATCGTC
CTGGAGGACTCCGCGGCGCTCGCCGGGCTCACCATCGCCTTCCTCGGCGTCTGGCTCGGG
CACCGCCTGGGAAACCCCTACCTCGACGGCGCGGCGTCGATCGGCATCGGCCTCGTGCTC
GCCGCGGTCGCGGTCTTCCTCGCCAGCCAGAGCCGTGGGCTCCTCGTGGGGGAGAGCGCG
GACAGGGAGCTCCTCGCCGCGATCCGCGCGCTCGCCAGCGCAGATCCTGGCGTGTCGGCG
GTGGGGCGGCCCCTGACGATGCACTTCGGTCCGCACGAAGTCCTGGTCGTGCTGCGCATC
GAGTTCGACGCCGCGCTCACGGCGTCCGGGGTCGCGGAGGCGATCGAGCGCATCGAGACC
CGGATACGGAGCGAGCGACCCGACGTGAAGCACATCTACGTCGAGGCCAGGTCGCTCCAC
CAGCGCGCGAGGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002524 Cation efflux protein (Family)
 [10-298]  2.99999999999998e-43 TIGR01297
TIGR01297   CDF
 [12-296]  4.5e-48 PF01545
PF01545   Cation_efflux
SignalP
 [1-28]  0.393 Signal
Bacteria, Gram-positive   
 [1-27]  0.365 Signal
Eukaryota   
TMHMM
 [7-29]  Transmembrane (i-o) [77-99]  Transmembrane (o-i) [112-134]  Transmembrane (i-o) [157-179]  Transmembrane (o-i) [186-208]  Transmembrane (i-o)
Transmembrane 5