close all open/close all
Epoth_00210 Epoth_00210   last last

CDS information : Epoth_00220


close this sectionLocation

Organism
StrainSo ce90
Entry nameEpothilone
Contig
Start / Stop / Direction68,346 / 68,750 / + [in whole cluster]
68,346 / 68,750 / + [in contig]
Location68346..68750 [in whole cluster]
68346..68750 [in contig]
TypeCDS
Length405 bp (134 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein(fragment)
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF15
Reference
ACC
PmId
[10662695] The biosynthetic gene cluster for the microtubule-stabilizing agents epothilones A and B from Sorangium cellulosum So ce90. (Chem Biol. , 2000)

close this sectionSequence

selected fasta
>hypothetical protein(fragment) [unknown]
MQTSSFDARYAGCKSSRRIARSGSAGARAGRAHEGAASAGFEGGDVMRKARAHGAMLGGR
DDGWRRGLPGAGALRAALQRGRSRDLARRRLIASVSLAGGASMAVVSLFQLGIIERLPDP
PLPGFDSAKVTSSDI
selected fasta
>hypothetical protein(fragment) [unknown]
GTGCAGACGTCGTCCTTCGACGCGAGGTACGCTGGTTGCAAGTCGTCACGCCGTATCGCG
AGGTCCGGCAGCGCCGGAGCCCGGGCGGGCCGGGCGCACGAAGGCGCGGCGAGCGCAGGC
TTCGAGGGGGGCGACGTCATGAGGAAGGCCAGGGCGCATGGGGCGATGCTCGGCGGGCGA
GATGACGGCTGGCGTCGCGGCCTCCCCGGCGCCGGCGCGCTTCGCGCCGCGCTCCAGCGC
GGTCGCTCGCGCGATCTCGCCCGGCGCCGGCTCATCGCCTCCGTGTCCCTCGCCGGCGGC
GCCAGCATGGCGGTCGTCTCGCTGTTCCAGCTCGGGATCATCGAGCGCCTGCCCGATCCT
CCGCTTCCAGGGTTCGATTCGGCCAAGGTGACGAGCTCCGATATC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-29]  0.51 Signal
Bacteria, Gram-negative   
TMHMM
 [92-114]  Transmembrane (i-o)
Transmembrane 1   
Epoth_00210 Epoth_00210   last last