close all open/close all
first first   FD891_00020 FD891_00020

CDS information : FD891_00010


close this sectionLocation

Organism
StrainA-8890
Entry nameFD-891
Contig
Start / Stop / Direction1,360 / 23,802 / + [in whole cluster]
1,360 / 23,802 / + [in contig]
Location1360..23802 [in whole cluster]
1360..23802 [in contig]
TypeCDS
Length22,443 bp (7,480 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)gfsA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[20589823] Cloning and characterization of the biosynthetic gene cluster of 16-membered macrolide antibiotic FD-891: involvement of a dual functional cytochrome P450 monooxygenase catalyzing epoxidation and hydroxylation. (Chembiochem. , 2010)

close this sectionPKS/NRPS Module

0 malonyl-CoA
1 methylmalonyl-CoA
2 methylmalonyl-CoA
3 malonyl-CoA
4 malonyl-CoA
KSQ26..398
AT564..876
ACP946..1016
KS1037..1404
AT1562..1886
KR2159..2338
ACP2443..2513
KS2538..2914
AT3069..3385
KR3711..3888
ACP3989..4059
KS4084..4464
AT4629..4926
KR5280..5459
ACP5562..5632
KS5654..6031
AT6189..6511
DH6560..6725
KR7037..7217
ACP7322..7396

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MNHIPVNRGVCLMGRSQNSEFETASDEPIAVIGLSCRLPKASGPQELWQLLDDGASAVTR
VPADRETPPSTEEESADGEAAGARWGGFLDRVDTFDAGFFGISPREAAAMDPQQRLVLEL
SWEALEGAGLVPATLRDTGLGVFVGAARDDYATLYRRREGRAVDHHAMTGLHRSLIANRI
SYALGAHGPSMVVDTGQSSSLVAVHLACESLRRGESDIALAGGVNLNIAAESARETAAFG
GLSPDGQCFTFDARANGFVRGEGGGLVVLKTLRRALADGDLVHGVILASAVNNDGPSDTL
TTPSRRAQESLLTRVYRRAGVTPTEVGYVELHGTGTKVGDPIEAAALGAVLGTGRDTPLP
VGSIKTNIGHLEGAAGIAGLIKALLQLRRRRLVPSLNFSTPNPDIPLDALNLRVQQESAP
WATPSGGGRTLVAGVSSFGMGGTNCHVVVSAAPVPEDGETTSEAGATGPDSGPALLPWVV
SARSPQACGTRPGDWPPGPTAAGREASPVDIGWSLATSRTHFEYRAVVSGSDRDELVASL
RALASGSPVTAAGAVDGGGRLGLVFSGQGSQRAGMGRELYVAFPVFAEAFDEVCGVLDEV
MGALPPSEGWAGSLREVMFEVSSDLLDETGFTQPALFAFEVALYRLLESWGVAGEVVAGH
SVGEIAAVHVAGVLSLADACALVAARGRLMQGLPSGGAMVAVEASEEEVTALLAGREGEV
GIGAVNGPRSVVVSGGVAVVEEVAAHFAGLGRRARRLKVSHAFHSPLMDPMLEDFGRVVA
GLSFAVPELTVVSGLTGAVVSADELCSVGYWVRHAREAVRFADAVGAMAGVGVGRFVEVG
PGGVLSALVRECLAEGGAGSVVAAVRGNRAEPVALLSAVGELFADGYPVDWTAYFAGWPA
ARVELPTYAFQRSRHWLENVPELAVSTTPPAVPREPVTPDSDHPDPVETVRQLTAHVLGL
TAAADVEMTRSFKDLGFDSLMSVELRDRLCAATGLSLATTLLYDHPSPAETAEFVRARLT
GDEAAAVEVVAARAVEDEPIAVVAMSCRFPGGVRTPEDLWELVRDRVDAVSVFPSDRGWN
ADAGLFPPAGGFLYDGHHFDAEFFGISPREALAMDPQQRLLLETSWEAFERAGIDPVSLR
GSRTGVFVGATAQDYTPKLGEPADGLEGHLLTGGTVSVASGRISYFLGLEGPAVTVDTAC
SSSLVSLHLACRSLRQGETTLALAGGVTLMATPGMFAEFSRQGGLAADGRCKAFAEAADG
TGWAEGVGLVLLERLSDARRNGHPVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALA
DARLAPADVDLMEAHGTGTRLGDPIEAQALLATYGQGRSGDRPLWLGSVKSNIGHTQAAA
GVAGLIKTVMAMRHGTMPATLHVDRPSSHVDWSTGAVELLTEAQPWPDTERPRRAAVSSF
GVSGTNAHVILEQATEPAALDAAPDAIVSDAVVAWPLSARDVGALREQAVRLVARVTGDP
YVRPADVGHSLAATRSSFEHRAVVVGRERAELLAGLEALASGETAANLATGRASADGAGK
VVFVFPGQGSQWPGMGLELAAHSPVFAAVLEDCGRALAAYVDWDGHTLHEVLAQEDGAPS
LERVDVVQPALWAVMVALAALWRSHGVQPDAVVGHSQGEIAAACVAGALTLDEAAQVVSL
RSRAITALAGAGQMVSVPLPEADTAEWIRPWADAGQIGIAAVNGPGSTVVSGDSAAMDEL
MEALAAQDVRARRIPVDYASHSPQVARIRDELLHALDGLTPRPATVPVFSTVTGEWLDDT
TPMDAEYWYRNLRQTVRFEEAVRALADSGCGVFIEASPHPVLTIGVQETLDVLDRTGVVT
GSLRRQKGGPDRFLSSLAQVHTHGGRVDWDTVFAGTGATRTDLPTYPFQRHRYWLERPQA
PAVAPAASPAASVSETDSTRYRVVFKPLPEPTAARLSGTWLLVVPDTDEPDARVDAVTGA
LVTAGATVERIVVEAGADRADLAELLAALATDVGGVRGVVSLLALSEDADAMRPSVPSGL
ASTLTLVQALGDADVSAPLWCLTRGAVSVGASDRLDSPVQALVWGLGRAAAVEHPERWGG
LLDLPATLTGRVLDRLVGVLAADGDEDQVAVRAAGVFGRRLVRGNSAPTRIDHSWQAGGT
VLVTGGTGALGARVARWLVDSGAEHVVVASRQGADAPGADRLRDELTGLGARVTPVACDV
SDRSAVAELVDRCAEQGDPIRAVVHTAGVGVTKPLADTTPDDLAVSFDAKVAGATHLADA
LGADLDAFVLFSSAAGVWGSGGQGAYGAANAYLDALAAQRAADGLAATAVAWGPWDGGGM
SADAAVIDMDALRRSGLTAMDPDRAIDALDRALTDGETALTVVDVDWTRFAEVFTTARRS
PLLADLPEAARLVGPAPTARENSSPVAARLAKASSAAEGRRVLLDLVRGRVADVLGHATP
DTIRADRPFKDLGFNSLMTLELRSGLNEATGLRLSATTLFDHPTPSALAEHLAGELLGTP
RAEAGPEMPATAPEVTEDPIAIVAMSCRFPGGVGSPEALWRLVADRRDVISGMPADRGWD
IDGIYDPVPGVPGRTYTRQGGFLDGVGEFDAEFFGISPREATAMDPQQRLLLETSWEAFE
RAGIDPTQLRGDSVGVFVGCTGQDYVPRLHETSDELGGYALTGAAGSVASGRVAYTFGLE
GPAVTVDTGCSASLVALHLAVQSLSRGECSLALAGGVTVMSNPGTFIEFSRQRGLAADGR
CKAFSDSADGTGWAEGVGMLLVERLSDARRNGHEVLAVVRGSAINQDGASNGLTAPNGRS
QQRVIRQALASASLTPAEVDVVEAHGTGTKLGDPIEAQALLATYGQDRPAERPLLLGALK
SNIGHTQAAAGVAGVIKMVLAMRHGVAPQTLHVEQPTAEVDWSAGAVELLTEARPWPDAD
RPRRAGVSAFGVGGTNAHVIIEEAQSAPAQERTAPEPPAALPWLVSGATPDALRAQAERL
LTHLADQPETHAADVAYSLSLTRSSLDHRAAVVAADRDELLAGLAALAEGRSAPGLVRGA
PHSGDRVAFVFPGQGSQWPGMAQELAAAFPAFAARLRACEDALAEFVDWSLTDVLSEAPD
APPLDRVDVVQPVLWAVMVSLAELWRSYGVEPDAVLGHSQGEIAAACVAGALTLQDAARV
VALRSKAIVAIAGQGGMLSVPLSREGLRPHLARWQDRLSVAAVNGPETVVLSGDVQAVDG
LCAELQGEQIRAKKIQVDYASHSAHVEAIEAELFDALAPITPRAGSVPFFSTVTGDWYDT
TGLDAGYWYRNLRQTVELHRATEALVEQGFGVFVESSPHPVLAVGMQDTVEAAGGDAVIL
GSLRRDDGGPDRFLRSLAEAHTHAVGVDWHALFTDGAGHRVELPTYAFQRKRYWLQDTAP
EHRADAPAVDPVDAAFWEAVEREDLDALAGVLDLGTPDDTASLDTVLPALPVLSSWRRKR
LDRSTVDAWRYRVEWRRIDDAPAPATLTGTWLVVIPEGYEADERVTASARALAERGADVV
EVRVDEAGEDRTALAERLSDTGADTGPVAGVLSFLALAEQGFPQHPEVPTGLALTLHLVQ
ALGDAGIDAPLWSVTSGAVSTGDDEAPSHPVQAHIWGMGRVAALEHSERWGGLVDLPEAP
DEQAARRLGAVLADTRGEDQVAIRPSGLYGRRLARAAATEAGERQRWTPRGTVLITGGTG
ALGAHVARRLAAQGAEHLVLVSRSGEAAPGADDLRTKLGVPVTVAACDIADRDQVAALLA
RLEADGTPVRTVVHTAGVARLTPLAQTDLAELADVLSGKAAGARHLLELLDLDNLDTFVL
FSSIAAAWGVADHGAYAAANAYLDAMALQYRAQGLPVSSVGWGPWDGDGMVSLNKLLARR
GIPVIAPDLAITALQQALDERDTYVAVADVDWDRFTQVFTSARPSPLLADFTETAADDRE
TASATAHGTDSELVRRLNALPEDERAQALQDLVLTEAAAVLGHTTTDALGAVRPYRDLGF
DSLTSVEFRNRLRDATGLALPATLVFDHPTPQATTEYLLQRIAGDKPIVDRASSSAVAAV
EADDPIAIVAMGCRYPGGVASPEELWELMAAEGDAISGFPTDRGWDLDALYDPDPDRAGH
TYVREGGFLHDAAEFDAEFFGISPREASAMDPQQRLLLETSWEAFERAGIDPAALRGSAT
GVFVGSNYQDYGLGSGSGSQQSSGVSEGHELIGSAPSVLSGRLSYTFGLEGPAVTVDTAC
SSSLVALHLAVQSLRQGESDLALAGGVAYMANPRAFVGFSRQRGLARDARCKAFADRADG
MTLAEGVGLVLLERLSDARRLGHPVLAVVRGSAINQDGASNGLTAPNGPAQQRVIRQALA
NARLTPSEVDVVEAHGTGTALGDPIEAQALLATYGQERVEGQPLWLGSVKSNIGHTQAAA
GVASVIKTVLAMGRGTVPATLHVDRPSSHVDWSAGAVELLTEARAWPENGHPRRAGVSSF
GISGTNAHVILEQAPAESGEPPQQDLPVDGESAASVVPWVVSARSVRALQAQAGQLAAWA
ASPAGEQASPADVAQALATTRTFFEYRTVVVGGDRAELVETLRSLSTDPSAAGTVRRADT
DGGGRLGLVFSGQGSQRAGMGRELYVAFPVFAEAFDEVCGVLDEVMGALPPSEGWAGSLR
EVMFDVAGGSLDETGFTQPALFAFEVALYRLLESWGVAGEVVAGHSVGEIAAVHVAGVLS
LADACALVAARGRLMQGLPSGGAMVAVEASEEEVTALLAGREGEVGIGAVNGPRSVVVSG
GVAVVEEVAAHFAGLGRRARRLKVSHAFHSPLMDPMLEDFGRVVAGLSFAVPELTVVSGL
TGAVVSADELCSVGYWVRHAREAVRFADAVGAMAGVGVGRFVEVGPGGVLSALVRECLAE
GGAGSVVAAVRGNRAEPVALVSAVGELFADGYPVDWTAYFAGWPAARVELPTYAFQRSRY
WLEELAGTAVRRTEAGGQDEVDAAFWEAVEQGDLSSLGTGEGVDGEARLADVLPVLSSWR
RQAGQVSLADSWRYRVTWNALPEPGVASFGGTWLLLAPAGSEAAGSLVRSLAEAMAEHGA
EVVTVDLGHPDSDRARDALAEQITGRLDGLAPGQVGGVVSLLALAEGTDPHHPTVSRGLA
LTLSAVQALGDAGVTAPLWCLTRGAVSAGATSGPDEPVQAQVWGLGRVAALEHPDRWGGL
LDLPEQVDSRTVRRLVRALAAGHRPGGEDQIALRTAGVLARRLVQDAAPAGDSVAWTPSG
TVLVTGGTGAVGGHVARWLAARGAERVVLVSRRGPEAPGAQALHDELTEAGVRVRLVACD
LRDQEAVTALVAGLADEGDLTAVVHAAGVLDDGVLASLSVERCAEVLAAKAQAAHHLDLA
TREVDLDAFVLFSSASGVLGSAGQANYAAANAYLDALAELRHALGLPAVSLAWGRWADGG
MADQDVVAGRLDRDGWPAMAAEAALNAMARAVTAGRPAVMVADVDWQRFAPAFTAARPSP
LLSALPQAQLPTAAAHGPAEGEQSSWASRLAELPAAEQQTALLDLIRGQVASVLGHASVQ
TIDPARAFKEIGFDSLTAVELRNRLNAATGLALPTTLVFDYPTPEALAEYVGSEVLGTSS
SAAVGGPLVVAAVDEPVAIIGMSCRFPGGVQSPEELWDLVAGGRDTISSFPADRGWDIDT
LFDPDGERSGTSSTRYGAFLDGAADFDPAFFDIGPREATAMDPQQRLLLETAWEAFERAG
IDPAALRGSATGVFTGTNGQDYATLASGAAAEFEGYLGIGNAGSVISGRLAYTFGLEGPA
MTVDTACSASLVALHLAAQALRQGECSLALAGGATVMATPGAFVEFSRQRGLAPDGRCKA
FSASADGTGWGEGAGMLLLERLSDAERNGHPILAVVRGSAVNQDGASNGLTAPNGPAQQR
VIRQALANARLSASEVDVVEAHGTGTKLGDPIEAQALLATYGQDRAEDRPLWLGSVKSNL
GHTQAAAGVAGIIKSVMAMRHGTLPATLHVDEPTPEVNWSTGAVELLTESRPWPATDHVR
RAAVSSFGVSGTNAHVILEQAADPVAEAESGAALVPDAVPVPWVVSARSADAVREQARRL
HTHLMTGREWRPADVGYSLATARSRFEHRAVVLGEDQGELLEALEALAEGRGDSRVRVGA
GLAGGRTGFVFAGQGSQRLGMGGRLREMFPVFGEAWDEVVAELDGRLGRPLGEVVFAEEG
SEQASLVDRTEFTQPALFAFEVALFRLLESWGVVPDVVAGHSIGELAAAYVAGVLSLSDA
CALVVARGRLMQALPAGGAMVAVQVTEAEARRLVEGEPSGAVDIAAVNGPESVVIAGDED
VVLRVQEIVRGRGRKTKRLTVSHAFHSPRMEPMLDEFRRVAETVTYHEPRIAVVSAVSGE
VAGAELRSAEYWTRHVREAVRFYDAVRCLRSEGVSTFVEVGPDGALSALGQDCLVGEEAR
GTEFVSTVRAGRDEAESVVAAVGAAHVRGVPVDWAAYYAPYGPRRADLPTYAFEHQRYWL
DTSARPGRDATGLGLGSAEHPLLGAAVALADGDGVLLTGRLSLATHPWLADHQVQGAVLF
PGTAFVELALRAGEQVGADCVEELTLEVPLVLPERGGVQVQVVVGAADEQGGRPVTVHSR
PETGVDEPWTRHATGVLASGAATVPAETGELAVWPPQGATAVDIDGLYDRLVDGGFGYGP
VFQGLRAVWRRGSEVFAEVALDDTHRDGAGEFGLHPALLDAALHAIGFGEFVSDGGAGVL
PFSWNGVHLYASGADALRVRVSGVGVGANEVALVVADGSGRPVAAVESLVLRPVSADTIA
AGAGARQSLFRVGWRQVAVPDQAGAGEWVALDRGAGWAQGEGCEVLPDLAALGSAVSAGR
SVPRLVVAHFAADREVPVTAGVRGVTAEGLELIQSWLADERFADSRLVIMTRQAVAVDAG
EGVFDLGAAALWGLVRTAQSEQPGRVVLVDVDDLDAVSRVVGIGDEPQLAVRDGRVFVPR
LMRAEAIDGVPVWDPEGTLLITGASGALGGVVARHVVREWGVRHLVLASRRGAEAPGMTE
LVAELGELGASAAPVACDVADRDALAAVLAGIPAVHRLAGVVHAAGVLDDGVVGSLTPER
LETVLAPKADAAWHLHELAAELDLSVFVLFSSAASVFGGAGQGNYAAANAFLDALAARRR
ADGLVATSLSWGLWDQAGGMTGQLGEADVARMSRSGVLPISVGEALPLLDAGVTGGDAWL
APVRLDLAALRQQAIATGGVPALLRDLVRVPNRRKAETGGSSTGGSRSTLLDKLAGLTDA
EREQELLDFVCEHTAAVLGHSGAGMVDPGRGFLEAGVDSLAAVELRNRIGGVLGIRLSAT
LVFDYPSPVLLAGHIGEQLALDEPAPEPMMAAELERLEAAVTAGRFDDASRDEVAVRLRK
LLTYFDTVADTARGETDDGDVASASVDELFALLDEELDDR
selected fasta
>polyketide synthase [polyketide synthase]
GTGAATCACATTCCGGTGAACCGTGGGGTGTGCTTGATGGGTAGGTCCCAGAACAGCGAG
TTCGAAACGGCGAGCGACGAACCGATAGCCGTGATCGGCCTGTCCTGCCGCCTTCCGAAG
GCTTCGGGCCCGCAGGAACTCTGGCAGCTGCTCGACGACGGGGCATCCGCGGTCACACGC
GTGCCGGCGGACCGGGAGACCCCGCCGTCCACGGAGGAGGAGTCAGCCGACGGCGAGGCC
GCGGGCGCCCGCTGGGGCGGCTTCCTCGACCGGGTCGACACCTTCGACGCGGGTTTCTTC
GGCATCTCCCCCAGGGAAGCCGCCGCCATGGACCCGCAGCAGCGGCTCGTACTCGAACTG
AGCTGGGAGGCGCTCGAAGGGGCGGGGCTCGTCCCGGCCACTTTGCGCGACACCGGACTC
GGCGTCTTCGTCGGAGCGGCCCGCGACGACTACGCGACCCTGTACCGGCGGCGGGAAGGG
CGAGCCGTCGACCACCACGCCATGACCGGACTGCACCGCAGCCTGATCGCCAACCGCATC
TCCTATGCCCTGGGTGCCCACGGTCCCAGCATGGTCGTGGACACCGGACAGTCCTCATCC
CTCGTCGCCGTGCACCTCGCCTGCGAGAGCCTGCGCCGCGGCGAATCGGACATCGCCCTC
GCCGGCGGCGTCAACCTCAACATCGCCGCCGAGAGCGCACGGGAGACGGCCGCCTTCGGC
GGTCTCTCCCCGGACGGACAGTGCTTCACCTTTGACGCCAGGGCCAACGGCTTCGTCCGC
GGGGAGGGCGGCGGCCTGGTCGTCCTCAAAACCCTGCGCCGGGCACTGGCCGACGGCGAC
CTCGTCCACGGGGTGATCCTCGCCAGCGCCGTCAACAACGACGGCCCGTCGGACACCCTC
ACCACGCCCAGCCGACGGGCCCAGGAGTCGCTCCTGACCCGCGTCTACCGGCGCGCGGGC
GTCACCCCGACCGAGGTCGGATACGTCGAACTGCACGGCACCGGCACCAAGGTGGGTGAC
CCGATCGAGGCGGCCGCCCTCGGTGCGGTACTCGGCACCGGGCGCGACACCCCGCTGCCG
GTGGGCTCGATCAAGACCAACATCGGCCACCTGGAGGGCGCCGCCGGAATCGCCGGCCTG
ATCAAGGCCCTGCTGCAACTCCGGCGCCGCCGACTGGTTCCGAGCCTCAACTTCAGCACC
CCCAACCCGGACATCCCGCTCGACGCGCTCAACCTCCGGGTCCAGCAGGAGTCCGCGCCG
TGGGCGACCCCGTCCGGGGGCGGCCGCACGCTCGTGGCCGGTGTCTCGTCGTTCGGCATG
GGCGGCACCAACTGCCACGTCGTGGTGTCGGCAGCGCCGGTCCCCGAGGACGGCGAGACG
ACGTCCGAGGCGGGGGCTACCGGTCCCGACTCCGGCCCGGCTCTGCTTCCCTGGGTGGTC
TCCGCCCGCTCGCCGCAGGCCTGCGGGACCAGGCCGGGCGACTGGCCGCCTGGGCCGACT
GCCGCTGGGCGGGAGGCGTCGCCGGTCGACATCGGCTGGTCCCTGGCGACCAGCCGGACG
CACTTCGAATACCGGGCCGTGGTGAGCGGCAGTGACCGGGACGAGCTGGTGGCAAGCCTG
CGGGCTCTCGCCTCGGGCAGCCCGGTGACCGCCGCGGGTGCCGTTGATGGCGGTGGTCGG
TTGGGGCTGGTCTTTTCGGGTCAGGGGTCTCAGCGGGCTGGTATGGGGCGGGAGTTGTAT
GTCGCGTTTCCGGTGTTCGCGGAGGCTTTCGATGAGGTGTGCGGGGTTCTCGATGAGGTG
ATGGGGGCGTTGCCGCCGTCGGAGGGCTGGGCCGGTTCTCTGCGTGAGGTGATGTTCGAG
GTCTCTTCCGACCTGCTGGATGAGACGGGGTTCACGCAGCCGGCGTTGTTCGCGTTCGAG
GTGGCGTTGTACCGGCTGCTGGAGTCGTGGGGTGTGGCCGGTGAGGTCGTAGCCGGTCAC
TCGGTGGGTGAGATCGCGGCTGTGCATGTGGCCGGGGTGTTGTCGCTGGCGGACGCGTGT
GCGTTGGTGGCGGCGCGTGGTCGTTTGATGCAGGGGTTGCCTTCGGGTGGGGCGATGGTG
GCGGTGGAGGCCTCGGAGGAGGAGGTCACCGCGCTTTTGGCGGGTCGTGAGGGTGAGGTC
GGGATCGGTGCGGTCAATGGTCCGCGTTCGGTGGTCGTCTCCGGTGGCGTGGCTGTGGTG
GAGGAGGTTGCCGCGCACTTTGCCGGGTTGGGGCGTCGTGCGCGTCGGCTGAAGGTGTCG
CACGCGTTCCACTCGCCTTTGATGGATCCGATGCTGGAGGACTTCGGTCGGGTGGTGGCG
GGGTTGTCCTTTGCCGTGCCGGAGTTGACGGTGGTGTCCGGTCTGACGGGCGCGGTTGTG
TCTGCTGACGAGTTGTGCTCGGTGGGGTACTGGGTCCGGCATGCGCGGGAGGCGGTGCGT
TTCGCGGATGCTGTGGGGGCTATGGCGGGTGTGGGTGTCGGCCGTTTCGTGGAGGTCGGG
CCCGGGGGTGTGCTGAGCGCGCTGGTCCGGGAGTGCCTTGCTGAGGGTGGCGCTGGGAGT
GTGGTGGCGGCGGTGCGGGGCAACCGGGCCGAGCCGGTCGCGTTGCTGTCGGCGGTGGGT
GAGCTGTTCGCGGACGGTTACCCGGTGGACTGGACGGCGTACTTCGCGGGGTGGCCTGCC
GCACGCGTCGAGTTGCCGACGTATGCCTTCCAACGCTCCCGCCACTGGCTGGAGAACGTT
CCCGAACTCGCCGTCTCCACGACCCCGCCTGCCGTTCCCCGCGAACCGGTGACACCGGAC
TCGGACCACCCGGATCCCGTCGAGACCGTACGGCAGTTGACCGCTCACGTGCTCGGTCTC
ACCGCTGCCGCCGACGTGGAAATGACGCGTTCCTTCAAGGACTTGGGGTTCGACTCCCTC
ATGTCCGTGGAGCTGCGTGACCGGCTGTGCGCGGCCACCGGGCTGTCGCTCGCCACGACG
CTTCTCTACGACCACCCGTCACCCGCCGAGACGGCGGAGTTCGTCCGGGCGCGGCTGACG
GGGGACGAGGCCGCCGCCGTCGAGGTCGTGGCGGCACGGGCCGTCGAGGACGAACCGATC
GCCGTCGTGGCGATGAGCTGCCGGTTCCCCGGTGGCGTACGGACGCCCGAGGACCTGTGG
GAGCTGGTCCGTGACCGTGTCGACGCGGTGTCCGTGTTCCCGTCGGACCGTGGCTGGAAC
GCCGACGCGGGGCTGTTCCCGCCCGCCGGTGGCTTCCTCTACGACGGTCATCACTTCGAC
GCGGAGTTCTTCGGGATCTCGCCACGCGAGGCCCTGGCGATGGATCCGCAGCAGCGGCTG
CTGCTGGAGACCTCCTGGGAGGCGTTCGAGCGCGCGGGCATCGACCCGGTTTCCCTACGG
GGCAGCCGTACCGGCGTGTTCGTCGGCGCCACCGCGCAGGACTACACCCCGAAGCTCGGC
GAGCCCGCTGACGGGCTCGAAGGGCATCTGCTGACCGGCGGCACGGTCAGTGTGGCCTCC
GGCCGGATCTCCTACTTCCTCGGGCTGGAGGGCCCCGCGGTGACCGTGGACACGGCGTGC
TCGTCGTCGCTGGTGTCCCTGCATCTGGCGTGCCGGTCCCTGCGGCAGGGGGAGACCACG
CTGGCCCTGGCCGGCGGTGTGACGCTGATGGCCACGCCGGGCATGTTCGCCGAGTTCTCC
CGCCAGGGCGGGCTCGCGGCGGACGGCCGCTGCAAGGCGTTCGCCGAGGCCGCCGACGGC
ACCGGCTGGGCCGAGGGCGTCGGGCTGGTGCTGCTGGAGCGGCTGTCCGACGCCCGGCGC
AACGGCCACCCCGTGCTGGCGGTGGTGCGGGGCAGCGCCGTCAACCAGGACGGCGCCAGC
AACGGCCTGACCGCGCCCAACGGTCCCTCGCAGCAGCGGGTGATCCGGCAGGCGCTGGCC
GACGCGCGGCTGGCGCCCGCCGACGTGGACCTGATGGAGGCGCACGGCACCGGCACGAGG
CTGGGCGACCCGATCGAGGCCCAGGCACTGCTGGCCACCTACGGGCAGGGTCGGTCCGGC
GACCGGCCGCTGTGGCTGGGGTCGGTCAAGTCGAACATCGGGCACACCCAGGCCGCCGCC
GGTGTCGCGGGCCTCATCAAGACGGTGATGGCGATGCGGCACGGCACGATGCCCGCCACA
TTGCACGTCGACCGGCCGTCCTCGCACGTGGACTGGTCGACCGGTGCCGTGGAACTCCTC
ACCGAGGCACAGCCCTGGCCGGACACCGAACGGCCGCGTCGTGCCGCCGTCTCCAGCTTC
GGCGTCAGCGGCACCAACGCCCACGTCATCCTCGAACAGGCCACCGAACCCGCTGCTCTG
GATGCGGCCCCCGACGCCATCGTCTCCGACGCCGTCGTCGCCTGGCCGCTGTCCGCCCGG
GACGTCGGCGCGCTGCGCGAGCAGGCGGTACGGCTGGTCGCCCGGGTCACCGGCGACCCG
TACGTACGTCCGGCGGACGTCGGCCACTCGCTCGCCGCGACCCGCTCGTCCTTCGAACAC
CGCGCGGTGGTCGTCGGACGGGAGCGGGCGGAACTGCTCGCCGGGCTTGAGGCGCTGGCC
TCGGGGGAGACGGCCGCGAACCTGGCGACCGGGCGGGCCTCGGCGGACGGCGCCGGGAAG
GTCGTGTTCGTCTTCCCCGGCCAGGGCTCGCAGTGGCCCGGCATGGGCCTGGAACTGGCC
GCGCACTCCCCGGTGTTCGCGGCCGTACTGGAGGACTGCGGCCGGGCGCTGGCCGCGTAC
GTGGACTGGGACGGCCACACGCTGCACGAGGTGCTGGCGCAGGAGGACGGCGCCCCGTCG
CTGGAGCGCGTGGACGTCGTACAGCCCGCGCTGTGGGCGGTCATGGTGGCTCTGGCGGCG
CTGTGGCGGTCCCACGGTGTCCAGCCGGACGCGGTCGTGGGCCACTCCCAGGGCGAGATC
GCGGCGGCCTGCGTCGCCGGAGCGCTGACGCTCGACGAGGCCGCCCAGGTCGTGTCTCTG
CGCTCGCGGGCGATCACCGCGCTGGCCGGTGCGGGCCAGATGGTGTCCGTACCGCTCCCG
GAGGCCGACACGGCCGAGTGGATCAGGCCGTGGGCCGACGCCGGGCAGATCGGCATCGCC
GCGGTGAACGGTCCGGGCTCGACCGTGGTGTCCGGTGACTCCGCGGCCATGGACGAGCTG
ATGGAGGCGCTCGCCGCCCAGGACGTCCGCGCCCGGCGGATCCCGGTGGACTACGCCTCG
CACAGCCCGCAGGTGGCCCGTATCCGTGACGAACTGCTGCACGCCCTGGACGGGTTGACC
CCGCGTCCGGCGACCGTCCCGGTGTTCTCCACGGTGACCGGCGAGTGGCTGGACGACACC
ACCCCGATGGACGCCGAGTACTGGTACCGCAATCTGAGGCAGACCGTCCGGTTCGAGGAG
GCCGTGCGCGCGCTGGCCGATTCCGGATGCGGTGTGTTCATCGAGGCCAGCCCGCATCCG
GTGCTGACGATCGGTGTGCAGGAGACCCTGGACGTACTCGACCGGACCGGTGTCGTCACC
GGCTCCCTGCGCCGCCAGAAGGGCGGCCCCGACCGCTTCCTCAGCTCCCTCGCCCAGGTG
CACACCCACGGCGGTCGCGTCGACTGGGACACGGTGTTCGCCGGTACCGGCGCCACCCGC
ACGGACCTCCCCACCTACCCCTTCCAGCGCCACCGCTACTGGCTGGAGCGCCCCCAGGCC
CCGGCCGTGGCGCCGGCCGCGTCCCCGGCCGCGAGCGTGTCCGAGACCGACTCGACCCGC
TACCGGGTGGTCTTCAAGCCGCTGCCCGAGCCGACCGCCGCCCGGCTCTCCGGGACCTGG
CTGCTCGTGGTGCCGGACACCGACGAGCCCGACGCGCGCGTCGACGCGGTCACGGGGGCG
CTGGTCACGGCGGGCGCGACGGTCGAGCGGATCGTCGTCGAGGCGGGCGCGGACCGTGCG
GACCTCGCCGAGCTGCTCGCGGCCCTGGCCACGGACGTCGGTGGCGTGCGCGGAGTGGTG
TCGCTGCTGGCCCTGAGCGAGGACGCCGACGCGATGCGCCCCTCGGTGCCGTCCGGCCTG
GCGTCGACACTCACCCTGGTCCAGGCCCTCGGCGACGCCGACGTGAGCGCCCCGCTGTGG
TGCCTGACCCGGGGCGCGGTGTCCGTGGGCGCATCGGACCGGTTGGACAGCCCCGTCCAG
GCGCTGGTGTGGGGCCTCGGCCGGGCCGCCGCCGTCGAACACCCCGAACGCTGGGGCGGA
CTGCTGGACCTGCCCGCGACTCTGACCGGCCGTGTCCTGGACCGGTTGGTGGGCGTACTC
GCCGCGGACGGCGACGAGGACCAGGTCGCGGTCCGGGCGGCGGGCGTGTTCGGCCGTCGG
CTCGTACGCGGGAACTCGGCGCCGACCCGTATCGACCACAGCTGGCAGGCCGGCGGAACC
GTGCTCGTGACCGGCGGCACCGGAGCGCTCGGTGCCAGGGTCGCCCGCTGGCTCGTGGAC
AGCGGCGCCGAGCACGTGGTGGTCGCCAGTCGACAAGGGGCGGACGCGCCGGGTGCGGAC
CGGCTGCGGGACGAACTCACCGGGCTGGGCGCCCGGGTCACGCCGGTCGCCTGCGACGTC
TCCGACCGGAGTGCCGTGGCCGAGCTGGTCGACCGGTGCGCGGAGCAGGGCGATCCCATC
CGAGCCGTGGTGCACACGGCCGGTGTCGGCGTGACCAAGCCGCTCGCCGACACCACGCCG
GACGACCTCGCCGTGTCCTTCGACGCCAAGGTCGCCGGAGCCACACACCTGGCCGACGCC
CTCGGCGCCGACCTCGACGCCTTCGTGCTGTTCTCCTCGGCGGCCGGGGTCTGGGGCAGC
GGCGGGCAGGGCGCGTACGGCGCCGCCAACGCCTACCTCGACGCGCTGGCCGCCCAGCGG
GCCGCCGACGGCCTGGCCGCCACGGCCGTCGCCTGGGGCCCCTGGGACGGCGGAGGCATG
TCCGCCGACGCGGCCGTCATCGACATGGACGCGCTGCGCCGCAGCGGCCTGACGGCCATG
GACCCCGACCGCGCGATCGACGCCCTCGACCGCGCGCTCACCGACGGTGAGACCGCCCTG
ACCGTGGTCGACGTGGACTGGACACGGTTCGCCGAGGTGTTCACCACCGCCCGCCGCAGC
CCCCTGCTGGCCGACCTGCCCGAGGCGGCGCGCCTCGTCGGCCCCGCGCCGACGGCCCGG
GAGAACTCATCCCCCGTGGCCGCCCGCCTCGCGAAGGCGTCGTCCGCGGCGGAGGGCCGC
CGCGTCCTGCTCGACCTCGTACGCGGCCGGGTCGCCGACGTGCTCGGACACGCCACGCCC
GACACGATCCGCGCCGACCGGCCCTTCAAGGACCTCGGCTTCAACTCGCTGATGACGCTG
GAACTCCGCAGCGGCCTCAACGAGGCCACCGGGCTACGGCTGTCCGCCACGACCCTCTTC
GACCATCCGACCCCGTCCGCGCTGGCCGAACACCTGGCGGGCGAACTCCTCGGCACACCG
CGCGCGGAAGCCGGGCCCGAGATGCCCGCGACGGCACCCGAGGTGACCGAGGACCCGATC
GCGATCGTTGCCATGAGCTGCCGTTTCCCCGGCGGAGTGGGCTCACCGGAAGCGCTGTGG
CGGTTGGTCGCCGACCGGCGTGACGTGATCTCCGGCATGCCGGCCGACCGCGGCTGGGAC
ATCGACGGCATCTACGACCCCGTACCGGGCGTGCCCGGCAGGACGTACACACGGCAGGGC
GGATTCCTCGACGGCGTCGGCGAGTTCGACGCGGAATTCTTCGGGATCTCACCGCGCGAG
GCGACCGCGATGGACCCGCAGCAGCGGCTGCTCCTGGAGACCTCCTGGGAGGCCTTCGAA
CGCGCCGGAATCGACCCGACCCAGCTGCGCGGCGACAGCGTCGGCGTCTTCGTCGGCTGC
ACCGGCCAGGACTACGTGCCCCGCCTCCACGAGACGAGCGACGAACTCGGCGGCTACGCC
CTGACCGGCGCCGCGGGCAGCGTGGCCTCCGGCCGGGTGGCGTACACCTTCGGCCTGGAG
GGACCGGCCGTCACCGTCGACACGGGCTGCTCGGCCTCGCTGGTGGCCCTGCACCTGGCC
GTGCAGTCGCTGAGCCGGGGCGAGTGCTCGCTCGCGCTGGCGGGCGGTGTCACCGTCATG
TCGAACCCCGGCACGTTCATCGAGTTCAGCCGGCAGCGGGGCCTCGCCGCCGACGGCCGC
TGCAAGGCGTTCTCCGACTCGGCCGACGGCACCGGCTGGGCCGAGGGCGTGGGCATGCTC
CTCGTGGAGCGGCTGTCCGACGCGCGGCGCAACGGCCATGAGGTCCTCGCGGTCGTCCGG
GGCAGCGCCATCAACCAGGACGGCGCCAGCAACGGCCTCACGGCACCCAACGGGCGTTCC
CAGCAGCGGGTCATCCGGCAGGCGCTCGCCAGTGCCTCCCTGACGCCCGCCGAGGTCGAC
GTCGTCGAGGCGCACGGCACCGGCACCAAGCTCGGCGACCCCATCGAGGCACAGGCCCTG
CTCGCCACCTACGGCCAGGACCGGCCCGCCGAACGGCCGCTGCTGCTCGGCGCGTTGAAG
TCGAACATCGGGCACACCCAGGCCGCCGCCGGTGTCGCCGGCGTGATCAAGATGGTGCTG
GCGATGCGGCACGGTGTGGCGCCGCAGACCCTGCACGTGGAGCAGCCGACCGCCGAGGTC
GACTGGTCGGCCGGAGCGGTGGAGCTGCTGACCGAGGCCCGGCCCTGGCCGGACGCGGAC
CGGCCCCGCCGGGCAGGTGTGTCGGCCTTCGGCGTCGGCGGCACCAACGCCCACGTCATC
ATCGAAGAGGCTCAGTCGGCACCGGCTCAGGAGCGGACCGCCCCTGAGCCCCCGGCCGCG
CTCCCGTGGCTCGTGTCCGGCGCCACGCCCGACGCGCTGCGCGCCCAGGCCGAGCGGCTG
CTCACCCACCTCGCCGACCAGCCGGAGACGCACGCCGCGGACGTGGCGTACTCGCTGTCC
CTGACCCGTTCCTCCCTGGACCACCGCGCGGCGGTGGTCGCCGCCGACCGGGACGAACTC
CTCGCCGGCCTCGCCGCACTGGCCGAGGGCCGCTCCGCACCCGGCCTCGTCCGGGGCGCG
CCGCACAGCGGGGACCGGGTCGCCTTCGTCTTCCCCGGCCAGGGCTCCCAGTGGCCCGGC
ATGGCTCAGGAACTCGCCGCGGCCTTCCCGGCGTTCGCCGCCCGGCTGCGCGCCTGCGAG
GACGCCCTCGCGGAGTTTGTCGACTGGTCCCTGACGGACGTACTGAGCGAGGCGCCCGAC
GCCCCACCGCTCGACCGCGTCGACGTGGTCCAGCCCGTCCTGTGGGCCGTCATGGTCTCG
CTGGCCGAGCTGTGGCGCTCGTACGGGGTGGAGCCCGACGCCGTACTCGGCCACAGCCAG
GGCGAGATCGCCGCCGCCTGCGTCGCGGGCGCTCTCACACTCCAGGACGCGGCCCGCGTC
GTGGCCCTGCGCAGCAAGGCGATCGTCGCCATCGCGGGCCAGGGCGGCATGCTGTCGGTC
CCGCTCTCCCGCGAGGGGCTGCGCCCCCATCTGGCGCGCTGGCAGGACCGGTTGTCCGTC
GCCGCCGTCAACGGCCCCGAGACGGTCGTCCTCTCCGGCGACGTCCAGGCCGTCGACGGT
CTCTGCGCGGAACTCCAGGGGGAGCAGATCCGCGCCAAGAAGATCCAGGTGGACTACGCG
TCGCACTCCGCCCACGTCGAGGCCATCGAGGCCGAACTCTTCGACGCCCTCGCCCCGATC
ACACCGCGCGCGGGCTCCGTCCCGTTCTTCTCCACCGTGACGGGCGACTGGTACGACACC
ACCGGCCTCGACGCCGGCTACTGGTACCGCAACCTGCGCCAGACCGTGGAACTCCACCGC
GCGACCGAGGCCCTGGTCGAGCAGGGATTCGGCGTCTTCGTCGAGTCGAGCCCGCATCCG
GTGCTCGCCGTCGGTATGCAGGACACCGTAGAGGCGGCGGGCGGCGACGCCGTGATCCTC
GGCTCGCTGCGCCGCGACGACGGCGGCCCCGACCGCTTCCTGCGCTCCCTCGCCGAGGCA
CACACGCACGCGGTCGGCGTCGACTGGCACGCCCTGTTCACGGACGGTGCCGGACACCGC
GTGGAGCTGCCGACGTACGCCTTCCAGCGCAAGCGCTACTGGCTCCAGGACACCGCCCCG
GAGCACCGGGCCGATGCCCCGGCCGTCGACCCCGTGGACGCGGCCTTCTGGGAGGCGGTC
GAACGCGAGGACCTCGACGCGCTGGCCGGCGTCCTGGACCTCGGCACGCCGGACGACACC
GCGTCCCTCGACACCGTGCTGCCCGCGCTGCCTGTGCTGTCGTCATGGCGCAGGAAGCGG
CTCGACCGGTCCACCGTCGACGCCTGGCGCTACCGCGTCGAGTGGCGCCGGATCGACGAC
GCACCGGCCCCGGCGACCCTGACCGGCACCTGGCTGGTCGTGATCCCCGAGGGGTACGAG
GCCGACGAGCGGGTCACCGCCTCGGCCCGGGCGCTGGCCGAACGCGGCGCCGACGTCGTG
GAGGTGCGGGTCGACGAGGCCGGCGAGGACCGGACGGCGCTCGCCGAGCGACTCTCCGAC
ACCGGCGCCGACACCGGCCCAGTCGCCGGGGTCCTCTCCTTCCTCGCCCTCGCCGAGCAA
GGGTTCCCGCAGCACCCCGAGGTGCCCACCGGACTCGCGCTGACCCTGCACCTCGTCCAG
GCGCTCGGCGACGCCGGAATCGACGCGCCCCTGTGGTCCGTGACGTCCGGCGCGGTGTCG
ACCGGCGACGACGAGGCACCCAGCCACCCGGTGCAGGCCCACATCTGGGGCATGGGCCGG
GTCGCCGCCCTGGAGCACTCCGAACGCTGGGGAGGCCTCGTGGACCTTCCCGAGGCGCCG
GACGAGCAGGCCGCGCGACGGCTGGGGGCGGTGCTGGCCGACACCAGGGGCGAGGACCAG
GTGGCGATCCGCCCCTCGGGGCTGTACGGCCGCCGACTGGCACGAGCGGCCGCCACGGAA
GCCGGCGAACGGCAGCGGTGGACCCCGCGGGGCACCGTGCTCATCACCGGCGGCACCGGC
GCCCTCGGCGCGCATGTCGCACGCCGCCTCGCCGCTCAGGGCGCCGAACACCTCGTCCTG
GTCAGCAGGTCGGGCGAGGCCGCGCCGGGCGCCGACGACCTCCGCACCAAGCTCGGCGTC
CCCGTGACGGTGGCCGCCTGCGACATCGCCGACCGCGACCAGGTCGCCGCCCTGCTGGCG
CGGCTCGAAGCCGACGGCACCCCTGTCCGTACGGTGGTGCACACCGCGGGCGTCGCCCGG
CTGACCCCGCTCGCACAGACGGACCTCGCCGAACTGGCCGACGTCCTGTCCGGCAAGGCA
GCCGGCGCCCGGCACCTCCTCGAACTCCTCGACCTCGACAACCTCGACACCTTCGTCCTC
TTCTCCTCCATCGCCGCGGCCTGGGGAGTCGCGGACCACGGCGCGTACGCGGCCGCCAAC
GCCTACCTGGACGCCATGGCCCTCCAATACCGGGCACAGGGACTCCCGGTGTCCTCGGTG
GGCTGGGGCCCCTGGGACGGCGACGGCATGGTCTCGCTGAACAAGCTGTTGGCCCGGCGC
GGCATCCCCGTCATCGCCCCCGACCTCGCGATCACGGCACTGCAGCAGGCGCTGGACGAA
CGCGACACCTACGTGGCCGTCGCCGACGTGGACTGGGACCGCTTCACCCAGGTGTTCACC
TCGGCCCGCCCGAGCCCGCTGCTCGCCGACTTCACGGAGACGGCCGCCGACGACCGGGAA
ACGGCCTCCGCCACGGCCCACGGCACCGACTCGGAGCTGGTCCGCCGCCTGAACGCCCTC
CCCGAGGACGAACGTGCCCAGGCCCTCCAGGACCTGGTGCTCACCGAGGCCGCGGCCGTG
CTCGGGCACACGACGACGGACGCGCTCGGAGCCGTACGCCCCTACCGAGACCTCGGCTTC
GACTCCCTCACCTCCGTGGAGTTCCGCAACCGGCTGCGGGACGCCACCGGCCTCGCCCTG
CCCGCCACACTGGTCTTCGACCATCCGACACCGCAGGCCACGACCGAGTACCTCCTGCAA
CGGATCGCGGGTGATAAGCCGATCGTCGACCGGGCCTCTTCCAGCGCGGTCGCAGCCGTC
GAGGCGGACGACCCGATCGCGATCGTGGCGATGGGCTGCCGCTACCCGGGCGGGGTCGCC
TCGCCCGAGGAGCTGTGGGAGCTGATGGCCGCCGAGGGCGACGCCATCTCGGGCTTCCCC
ACGGACCGCGGCTGGGACCTGGACGCCCTGTACGACCCCGACCCGGACCGCGCGGGACAC
ACCTACGTCCGGGAAGGCGGCTTCCTGCACGACGCGGCCGAGTTCGACGCCGAGTTCTTC
GGGATCTCACCGCGTGAGGCGTCCGCCATGGACCCGCAGCAGCGGCTGCTGCTGGAGACG
TCCTGGGAGGCGTTCGAACGGGCGGGTATCGACCCGGCTGCGCTGCGCGGCAGTGCCACC
GGCGTCTTTGTCGGAAGCAACTACCAGGACTACGGACTGGGCTCGGGGTCGGGGTCGCAG
CAGAGCTCCGGGGTCTCCGAAGGGCACGAACTGATCGGCAGCGCGCCGAGCGTGCTCTCG
GGCCGGCTGTCGTACACCTTCGGCCTGGAGGGACCGGCGGTCACCGTGGACACGGCGTGC
TCGTCGTCGCTGGTGGCACTGCACCTGGCCGTGCAGTCCCTGCGGCAGGGCGAGTCCGAC
CTCGCTCTGGCCGGCGGTGTCGCCTACATGGCGAACCCCCGGGCCTTCGTCGGGTTCAGC
CGCCAGCGAGGGCTGGCACGGGACGCCCGCTGCAAGGCGTTCGCGGATCGCGCGGACGGG
ATGACCCTCGCCGAGGGCGTGGGGCTGGTGCTGTTGGAGAGGCTGTCGGACGCACGGCGG
CTCGGGCACCCGGTGCTCGCGGTCGTGCGGGGCAGCGCGATCAACCAGGACGGTGCGTCG
AACGGGCTTACGGCGCCGAACGGTCCCGCCCAGCAGCGGGTGATCCGGCAGGCGCTGGCG
AACGCCCGTCTGACGCCGTCCGAGGTGGATGTGGTGGAGGCGCACGGTACGGGCACGGCG
CTGGGTGACCCGATCGAGGCGCAGGCGCTGCTGGCCACGTACGGCCAGGAGCGGGTGGAA
GGCCAGCCGTTGTGGCTGGGGTCGGTGAAGTCGAACATCGGGCACACCCAGGCCGCCGCC
GGTGTCGCGAGTGTGATCAAGACCGTGCTGGCGATGGGGCGTGGCACGGTGCCGGCGACC
CTGCATGTGGACCGGCCGTCCTCGCACGTCGACTGGTCGGCGGGCGCGGTGGAACTCCTC
ACCGAGGCACGCGCCTGGCCCGAGAACGGCCACCCGCGCCGCGCCGGTGTGTCCTCGTTC
GGTATCAGCGGTACGAACGCGCACGTCATCCTGGAGCAGGCTCCGGCCGAGTCCGGGGAG
CCGCCGCAGCAGGACCTGCCCGTCGATGGGGAATCCGCCGCGTCGGTGGTGCCGTGGGTG
GTGTCGGCGCGGTCGGTGCGGGCGCTCCAGGCACAGGCCGGGCAACTGGCCGCCTGGGCC
GCGTCACCCGCCGGTGAGCAGGCGAGCCCGGCGGACGTCGCCCAGGCGCTCGCCACGACG
CGCACCTTCTTCGAGTACCGGACGGTGGTGGTCGGCGGCGACCGGGCCGAACTGGTCGAG
ACGTTGCGGTCGCTGAGCACGGACCCGTCGGCTGCGGGAACGGTACGGCGCGCCGACACC
GACGGCGGTGGTCGGTTGGGGCTGGTCTTTTCGGGTCAGGGGTCTCAGCGGGCTGGTATG
GGGCGGGAGTTGTATGTCGCGTTTCCGGTGTTCGCGGAGGCTTTCGATGAGGTGTGCGGG
GTTCTCGATGAGGTGATGGGGGCGTTGCCGCCGTCGGAGGGCTGGGCCGGTTCTCTGCGT
GAGGTGATGTTCGATGTCGCCGGTGGGTCGCTGGATGAGACGGGGTTCACGCAGCCGGCG
TTGTTCGCGTTCGAGGTGGCGTTGTACCGGCTGCTGGAGTCGTGGGGTGTGGCCGGTGAG
GTCGTAGCCGGTCACTCGGTGGGTGAGATCGCGGCTGTGCATGTGGCCGGGGTGTTGTCG
CTGGCGGACGCGTGTGCGTTGGTGGCGGCGCGTGGTCGTTTGATGCAGGGGTTGCCTTCG
GGTGGGGCGATGGTGGCGGTGGAGGCCTCGGAGGAGGAGGTCACCGCGCTTTTGGCGGGT
CGTGAGGGTGAGGTCGGGATCGGTGCGGTCAATGGTCCGCGTTCGGTGGTCGTCTCCGGT
GGCGTGGCTGTGGTGGAGGAGGTTGCCGCGCACTTTGCCGGGTTGGGGCGTCGTGCGCGT
CGGCTGAAGGTGTCGCACGCGTTCCACTCGCCTTTGATGGATCCGATGCTGGAGGACTTC
GGTCGGGTGGTGGCGGGGTTGTCCTTTGCCGTGCCGGAGTTGACGGTGGTGTCCGGTCTG
ACGGGCGCGGTTGTGTCTGCTGACGAGTTGTGCTCGGTGGGGTACTGGGTCCGGCATGCG
CGGGAGGCGGTGCGTTTCGCGGATGCTGTGGGGGCTATGGCGGGTGTGGGTGTCGGCCGT
TTCGTGGAGGTCGGGCCCGGGGGTGTGCTGAGCGCGCTGGTCCGGGAGTGCCTTGCTGAG
GGTGGTGCTGGGAGTGTGGTGGCGGCGGTGCGGGGCAACCGGGCCGAGCCGGTCGCGTTG
GTGTCGGCGGTGGGTGAGCTGTTCGCGGACGGTTACCCGGTGGACTGGACGGCGTACTTC
GCGGGGTGGCCTGCCGCACGCGTCGAGTTGCCGACGTATGCCTTCCAACGCTCCCGCTAC
TGGCTGGAAGAGCTGGCCGGTACGGCCGTACGGCGGACCGAGGCCGGGGGCCAGGACGAG
GTGGACGCGGCCTTCTGGGAGGCCGTGGAGCAGGGCGATCTCTCCTCGCTCGGCACCGGT
GAGGGTGTGGACGGGGAGGCGCGGCTGGCGGATGTGCTGCCCGTGCTGTCGTCGTGGCGT
CGACAGGCTGGGCAGGTCTCGTTGGCCGACTCCTGGCGCTACCGGGTGACCTGGAACGCG
CTGCCCGAGCCAGGCGTGGCGTCGTTCGGCGGCACCTGGCTGTTGCTCGCCCCGGCCGGG
TCCGAGGCGGCGGGGTCCCTCGTCCGTTCCCTCGCCGAGGCCATGGCCGAGCACGGTGCC
GAGGTCGTCACCGTGGACCTCGGCCACCCCGACTCCGACCGGGCCCGCGATGCCCTGGCC
GAGCAGATCACCGGTCGGCTCGACGGCCTCGCCCCCGGTCAGGTCGGCGGAGTGGTGTCA
CTCCTGGCGCTGGCCGAGGGCACGGATCCGCACCACCCGACCGTTTCGCGTGGGCTGGCA
CTGACCCTGTCCGCCGTCCAGGCACTGGGTGACGCGGGAGTGACCGCCCCGCTGTGGTGT
CTGACGCGGGGCGCGGTCTCGGCGGGAGCGACAAGTGGGCCGGACGAACCGGTGCAGGCC
CAGGTGTGGGGCCTCGGCCGGGTCGCGGCCCTGGAGCACCCGGACCGCTGGGGCGGGCTG
CTCGATCTCCCCGAGCAGGTCGATTCCCGTACCGTACGGCGGCTCGTCCGGGCCCTGGCC
GCCGGTCACCGGCCCGGCGGCGAGGACCAGATCGCGCTGCGTACGGCCGGTGTCCTGGCC
CGGCGCCTGGTCCAGGACGCCGCACCCGCCGGTGACTCGGTGGCGTGGACGCCGTCGGGC
ACGGTCCTGGTGACCGGCGGTACCGGTGCCGTCGGTGGGCATGTGGCCCGTTGGCTGGCC
GCCCGGGGAGCCGAACGGGTGGTCCTGGTCAGTCGCCGCGGCCCCGAGGCCCCTGGAGCG
CAGGCACTGCACGACGAGCTGACCGAGGCCGGCGTACGTGTCCGGCTGGTCGCCTGCGAC
CTGCGTGACCAGGAGGCTGTGACCGCCCTGGTGGCCGGGCTGGCCGACGAGGGCGACCTG
ACCGCGGTCGTCCATGCGGCCGGCGTTCTCGACGACGGCGTACTGGCCTCCCTGTCCGTC
GAGCGGTGCGCCGAGGTCCTGGCGGCAAAGGCGCAGGCCGCCCACCATCTGGACCTGGCC
ACACGAGAGGTGGACCTGGACGCCTTCGTGCTGTTCTCCTCCGCCTCCGGTGTGCTGGGC
AGCGCCGGACAGGCCAACTACGCGGCCGCCAACGCCTACTTGGACGCGCTGGCCGAGCTC
CGGCACGCCCTCGGACTGCCCGCCGTCTCGCTCGCGTGGGGCCGGTGGGCCGACGGCGGC
ATGGCCGACCAGGACGTCGTCGCCGGACGACTGGACCGCGACGGCTGGCCCGCGATGGCA
GCCGAGGCGGCGCTGAACGCCATGGCTCGAGCCGTGACCGCCGGCCGACCGGCCGTGATG
GTCGCGGACGTGGACTGGCAGCGCTTCGCCCCGGCGTTCACCGCGGCCCGTCCCAGCCCG
CTGCTGTCCGCCCTGCCTCAGGCCCAGCTGCCGACGGCGGCGGCCCATGGCCCGGCGGAG
GGCGAGCAGTCGTCCTGGGCGAGTCGGCTGGCCGAGCTGCCCGCGGCGGAACAGCAGACG
GCCCTGCTGGACCTGATCCGTGGCCAGGTGGCGAGTGTGCTCGGCCATGCCTCGGTGCAG
ACGATCGATCCGGCGCGGGCGTTCAAGGAGATCGGCTTCGACTCGCTGACGGCGGTGGAG
CTGCGGAACCGTCTCAATGCGGCCACCGGCCTGGCCCTGCCCACCACGTTGGTCTTCGAC
TACCCGACGCCCGAGGCACTGGCCGAATACGTCGGCTCTGAGGTGCTGGGTACGTCGTCG
TCGGCTGCGGTCGGCGGTCCGTTGGTGGTGGCGGCCGTGGACGAGCCGGTCGCGATCATC
GGGATGAGCTGCCGTTTCCCCGGTGGTGTCCAGAGTCCCGAGGAGCTGTGGGACCTGGTG
GCCGGGGGCCGGGACACGATCTCGTCCTTCCCGGCCGACCGAGGCTGGGACATCGACACC
CTCTTCGACCCCGACGGGGAACGTTCCGGCACGAGCAGCACCCGCTATGGCGCGTTTCTC
GACGGCGCGGCCGACTTCGACCCCGCTTTCTTCGACATCGGGCCGCGTGAGGCCACGGCG
ATGGATCCGCAGCAGCGGCTGCTGCTGGAGACGGCGTGGGAGGCGTTCGAACGGGCCGGC
ATCGACCCGGCCGCGCTGCGCGGCAGCGCCACCGGCGTCTTCACCGGCACCAACGGCCAG
GACTACGCGACACTCGCCTCGGGCGCGGCAGCCGAGTTCGAGGGATACCTCGGCATCGGC
AACGCCGGCAGCGTCATCTCCGGGCGGCTGGCCTACACGTTCGGTCTGGAGGGGCCGGCC
ATGACCGTGGACACGGCGTGCTCCGCGTCGCTGGTCGCCCTGCACCTGGCCGCGCAGGCG
CTGCGACAGGGCGAGTGCTCGCTGGCGTTGGCCGGTGGCGCCACGGTGATGGCGACTCCG
GGCGCCTTCGTGGAGTTCAGCCGGCAGCGGGGGCTCGCTCCCGACGGCCGGTGCAAGGCG
TTCTCGGCCTCGGCGGACGGCACCGGCTGGGGCGAGGGCGCGGGCATGCTCCTGCTGGAG
CGCCTGTCGGACGCCGAGCGCAACGGCCACCCGATCCTGGCCGTCGTACGTGGCAGCGCG
GTCAACCAGGACGGCGCGTCGAACGGGCTGACGGCGCCGAACGGTCCCGCCCAGCAGCGG
GTGATCCGGCAGGCGTTGGCGAACGCCCGTCTGTCCGCGTCCGAGGTGGATGTGGTGGAG
GCGCACGGTACGGGGACGAAGCTGGGTGACCCGATCGAGGCGCAGGCACTCCTGGCCACC
TACGGCCAGGACCGGGCGGAGGACCGGCCGTTGTGGCTGGGCTCGGTGAAGTCGAACCTC
GGGCATACGCAGGCCGCCGCCGGTGTCGCCGGGATCATCAAGTCAGTCATGGCCATGCGG
CACGGCACGCTGCCGGCCACGCTGCACGTGGACGAGCCCACGCCGGAGGTGAACTGGTCG
ACGGGAGCGGTGGAACTGCTCACCGAGAGCCGCCCCTGGCCCGCCACCGATCACGTTCGC
CGCGCCGCGGTCTCCAGCTTCGGCGTCAGCGGCACGAACGCGCACGTCATCCTCGAACAA
GCTGCCGACCCGGTGGCCGAGGCAGAGTCCGGCGCGGCCCTCGTTCCCGACGCGGTCCCG
GTGCCATGGGTGGTGTCCGCCCGCAGCGCGGATGCCGTACGGGAGCAGGCCAGGCGCTTG
CACACGCATCTGATGACGGGTCGGGAGTGGCGTCCGGCCGATGTCGGGTACAGCCTCGCG
ACAGCCCGCTCTCGGTTCGAGCACCGGGCCGTCGTACTGGGCGAGGACCAGGGCGAGTTG
CTGGAGGCACTGGAGGCGCTGGCTGAGGGGCGTGGGGATTCCCGGGTGCGGGTCGGTGCT
GGGTTGGCCGGGGGGCGTACGGGGTTCGTGTTCGCGGGGCAGGGGTCGCAGCGGTTGGGT
ATGGGTGGCCGGCTTCGGGAGATGTTCCCTGTCTTCGGTGAGGCGTGGGACGAGGTGGTC
GCGGAGTTGGATGGGCGGCTGGGGCGGCCGTTGGGTGAGGTGGTGTTCGCGGAGGAGGGT
TCGGAACAGGCCTCGCTTGTGGATCGTACGGAGTTCACGCAGCCGGCGTTGTTCGCGTTC
GAGGTGGCGTTGTTCCGGCTGTTGGAGTCGTGGGGTGTGGTGCCCGATGTGGTGGCCGGG
CATTCGATCGGTGAGCTTGCGGCGGCGTATGTGGCGGGGGTGCTGTCGCTGTCGGATGCG
TGTGCGTTGGTGGTGGCGCGGGGCCGGTTGATGCAGGCGTTGCCGGCCGGTGGGGCGATG
GTGGCGGTGCAGGTCACGGAGGCCGAGGCACGGCGACTTGTCGAGGGTGAGCCTTCGGGT
GCGGTGGATATCGCGGCGGTGAATGGGCCGGAGTCCGTGGTGATCGCCGGTGACGAGGAC
GTGGTGCTGCGTGTCCAGGAGATCGTGCGCGGGCGGGGCCGTAAGACGAAGCGTTTGACG
GTGTCGCATGCGTTCCACTCGCCGCGCATGGAGCCGATGCTCGACGAGTTCCGCCGGGTG
GCCGAGACGGTGACTTATCACGAGCCTCGCATTGCGGTGGTCTCCGCGGTGTCGGGTGAG
GTGGCGGGTGCGGAGTTGCGGTCGGCGGAGTACTGGACGCGGCATGTGCGTGAGGCGGTG
CGCTTCTACGACGCGGTGCGGTGTCTGCGGAGCGAAGGCGTGAGCACGTTCGTGGAGGTC
GGTCCGGACGGGGCGTTGTCCGCGCTGGGGCAGGACTGCCTGGTCGGGGAGGAGGCGCGG
GGCACGGAGTTTGTGTCCACGGTGCGGGCCGGGCGCGATGAGGCCGAGAGCGTGGTGGCG
GCCGTGGGTGCGGCGCATGTGCGCGGTGTGCCGGTGGACTGGGCCGCGTACTACGCCCCG
TACGGCCCGCGTCGGGCGGACCTGCCGACCTACGCCTTCGAACATCAGCGGTACTGGCTG
GACACGTCCGCGCGGCCGGGACGCGACGCCACCGGACTGGGCCTGGGCTCGGCGGAGCAT
CCGTTGCTCGGCGCGGCGGTGGCCCTGGCGGATGGCGACGGGGTGTTGCTGACCGGGCGG
TTGTCGCTGGCGACGCATCCGTGGCTGGCGGATCACCAGGTGCAGGGTGCTGTGCTGTTC
CCCGGGACGGCGTTCGTGGAGCTTGCGTTGCGGGCCGGGGAGCAGGTGGGCGCGGACTGT
GTCGAGGAGCTGACGCTGGAGGTGCCGTTGGTGCTTCCGGAGCGTGGTGGTGTGCAGGTC
CAGGTGGTCGTCGGCGCTGCGGACGAGCAAGGTGGCCGTCCGGTGACGGTGCACTCCCGG
CCGGAGACAGGAGTCGACGAGCCCTGGACCCGGCACGCCACCGGTGTGCTGGCCTCCGGG
GCCGCGACTGTGCCGGCCGAGACCGGCGAACTCGCCGTGTGGCCTCCGCAGGGTGCGACG
GCTGTGGACATCGACGGGCTGTACGACCGGCTGGTGGACGGCGGCTTCGGTTACGGGCCG
GTGTTCCAGGGGCTGCGAGCGGTGTGGCGGCGCGGCTCGGAGGTGTTCGCCGAGGTCGCG
CTGGACGACACCCATCGCGACGGCGCGGGGGAGTTCGGTCTTCATCCGGCGCTGCTGGAT
GCGGCGTTGCACGCGATCGGGTTCGGGGAGTTCGTGAGTGACGGTGGGGCGGGGGTACTG
CCGTTCTCCTGGAACGGCGTGCACCTGTATGCGTCGGGTGCGGATGCGTTGCGGGTGCGG
GTGTCCGGGGTCGGCGTCGGGGCGAACGAGGTTGCGCTGGTGGTCGCGGACGGCTCCGGG
CGGCCGGTGGCCGCAGTTGAGTCCTTGGTGCTGCGGCCTGTGTCTGCGGACACGATCGCT
GCGGGAGCGGGTGCGCGGCAGTCGTTGTTCCGGGTGGGGTGGCGGCAGGTGGCCGTGCCG
GATCAGGCGGGTGCGGGGGAGTGGGTGGCCCTCGACCGGGGTGCTGGCTGGGCGCAGGGG
GAGGGGTGCGAGGTCCTGCCCGACCTGGCCGCGCTCGGCTCGGCGGTCTCCGCCGGCCGA
TCGGTGCCGCGTCTGGTGGTGGCGCATTTCGCCGCCGATCGTGAGGTGCCCGTCACGGCC
GGGGTGCGTGGAGTGACGGCTGAGGGACTGGAGTTGATCCAGTCCTGGCTGGCGGACGAG
AGGTTCGCCGACTCGCGGCTCGTGATTATGACCCGCCAGGCCGTCGCGGTGGATGCCGGT
GAGGGTGTCTTTGATCTGGGTGCGGCGGCGTTGTGGGGTCTGGTGCGTACGGCGCAGTCG
GAGCAGCCGGGCCGGGTCGTGCTGGTGGATGTGGATGACCTGGATGCGGTGTCCCGGGTG
GTCGGGATCGGTGATGAGCCGCAGCTCGCGGTGCGGGATGGCCGGGTGTTCGTGCCGCGT
CTGATGCGGGCCGAAGCCATTGATGGGGTGCCGGTGTGGGATCCCGAGGGCACGTTGTTG
ATCACGGGTGCGTCGGGTGCGTTGGGTGGTGTGGTCGCCCGGCATGTGGTCCGTGAGTGG
GGCGTACGGCACCTGGTTCTCGCGAGCCGTCGTGGCGCGGAGGCTCCCGGTATGACGGAA
CTGGTCGCGGAACTGGGTGAGTTGGGTGCTTCGGCTGCTCCGGTGGCCTGTGACGTGGCG
GACCGGGACGCGCTGGCTGCCGTACTGGCTGGTATTCCTGCCGTGCACCGGCTGGCGGGT
GTGGTCCATGCGGCTGGTGTCCTGGACGACGGCGTGGTGGGTTCGCTCACTCCTGAGCGG
TTGGAGACGGTCCTGGCGCCGAAGGCGGACGCGGCCTGGCATCTGCACGAGCTGGCCGCG
GAGCTGGACCTGTCGGTGTTCGTGCTGTTCTCTTCCGCGGCGAGTGTCTTCGGTGGTGCG
GGTCAGGGCAATTACGCCGCGGCGAATGCCTTCCTCGATGCGCTCGCGGCGAGGCGTCGG
GCCGATGGCCTGGTGGCGACCTCGCTCTCGTGGGGCCTGTGGGACCAGGCCGGCGGTATG
ACGGGGCAGTTGGGTGAGGCGGACGTGGCCCGGATGAGCCGTTCGGGCGTGCTGCCGATC
TCCGTCGGCGAGGCACTGCCGCTGCTTGACGCCGGTGTGACCGGCGGCGATGCCTGGCTG
GCGCCGGTCCGGCTGGACCTCGCCGCGCTGCGGCAGCAGGCCATCGCCACCGGGGGAGTG
CCCGCACTGCTCCGCGATCTGGTCCGCGTACCGAACCGCCGCAAGGCCGAAACCGGCGGC
AGCAGCACAGGCGGCTCCCGCTCGACCCTCCTCGACAAGCTCGCCGGACTGACCGACGCC
GAACGGGAGCAGGAACTGCTGGACTTCGTCTGCGAGCACACCGCGGCCGTACTGGGCCAC
TCCGGCGCCGGCATGGTCGACCCCGGCCGAGGCTTCCTCGAAGCGGGCGTGGACTCGCTG
GCCGCGGTGGAGCTGCGCAATCGCATCGGCGGCGTCCTCGGCATCCGGCTCTCGGCCACG
CTGGTCTTCGACTACCCCTCGCCGGTGCTGCTCGCCGGGCACATCGGGGAGCAACTCGCG
CTGGACGAACCCGCACCCGAGCCGATGATGGCCGCGGAGCTGGAGCGGTTGGAGGCCGCG
GTGACCGCGGGGCGCTTCGACGACGCCTCACGCGACGAGGTCGCCGTACGGCTGCGGAAA
CTCCTGACGTACTTCGACACCGTGGCCGACACCGCCAGGGGAGAGACCGACGACGGCGAT
GTCGCCTCGGCGAGCGTCGACGAACTCTTCGCCCTCCTCGACGAGGAACTCGACGACCGC
TGA
[0] KSQ26..398
[0] AT564..876
[0] malonyl-CoA761..765
[0] ACP946..1016
[1] KS1037..1404
[1] AT1562..1886
[1] methylmalonyl-CoA1758..1762
[1] KR2159..2338
[1] ACP2443..2513
[2] KS2538..2914
[2] AT3069..3385
[2] methylmalonyl-CoA3259..3263
[2] KR3711..3888
[2] ACP3989..4059
[3] KS4084..4464
[3] AT4629..4926
[3] malonyl-CoA4826..4830
[3] KR5280..5459
[3] ACP5562..5632
[4] KS5654..6031
[4] AT6189..6511
[4] malonyl-CoA6383..6387
[4] DH6560..6725
[4] KR7037..7217
[4] ACP7322..7396
[0] KSQ76..1194
[0] AT1690..2628
[0] malonyl-CoA2281..2295
[0] ACP2836..3048
[1] KS3109..4212
[1] AT4684..5658
[1] methylmalonyl-CoA5272..5286
[1] KR6475..7014
[1] ACP7327..7539
[2] KS7612..8742
[2] AT9205..10155
[2] methylmalonyl-CoA9775..9789
[2] KR11131..11664
[2] ACP11965..12177
[3] KS12250..13392
[3] AT13885..14778
[3] malonyl-CoA14476..14490
[3] KR15838..16377
[3] ACP16684..16896
[4] KS16960..18093
[4] AT18565..19533
[4] malonyl-CoA19147..19161
[4] DH19678..20175
[4] KR21109..21651
[4] ACP21964..22188

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [562-690]  G3DSA:3.40.366.10 [760-864]  G3DSA:3.40.366.10 [1556-1688]  G3DSA:3.40.366.10 [1758-1876]  G3DSA:3.40.366.10 [3060-3191]  G3DSA:3.40.366.10 [3259-3376]  G3DSA:3.40.366.10 [4627-4755]  G3DSA:3.40.366.10 [4825-4929]  G3DSA:3.40.366.10 [6185-6314]  G3DSA:3.40.366.10 [6383-6500]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [7037-7204]  1.29999999999998e-59 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [974-989]  PS00012 [2471-2486]  PS00012 [5590-5605]  PS00012 [7354-7369]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [948-1020]  2.20000000000002e-103 G3DSA:1.10.1200.10 [2442-2516]  2.20000000000002e-103 G3DSA:1.10.1200.10 [3987-4063]  2.20000000000002e-103 G3DSA:1.10.1200.10 [5559-5635]  2.20000000000002e-103 G3DSA:1.10.1200.10 [7324-7399]  2.20000000000002e-103 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [939-1054]  1.39999892049878e-25 SSF47336 [2435-2530]  7.19999557654549e-24 SSF47336 [3982-4100]  1.70000295590054e-25 SSF47336 [5555-5671]  1e-29 SSF47336 [7318-7413]  1e-19 SSF47336
SSF47336   ACP_like
 [946-1016]  PS50075 [2443-2513]  PS50075 [3989-4059]  PS50075 [5562-5632]  PS50075 [7322-7396]  PS50075
PS50075   ACP_DOMAIN
 [949-1015]  3.2e-10 PF00550 [2446-2512]  6.40000000000001e-14 PF00550 [3992-4058]  1.1e-09 PF00550 [5565-5631]  3.8e-13 PF00550 [7330-7395]  9.9e-08 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [2159-2337]  4.30000000000003e-59 PF08659 [3711-3887]  8.89999999999994e-55 PF08659 [5280-5458]  8.60000000000005e-62 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [26-274]  1.20000000000001e-82 PF00109 [1037-1278]  1e-86 PF00109 [2538-2788]  4.59999999999996e-97 PF00109 [4084-4338]  6.7999999999999e-99 PF00109 [5654-5905]  6.60000000000002e-98 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [284-398]  4.80000000000003e-39 PF02801 [1286-1404]  8.89999999999994e-50 PF02801 [2796-2914]  8.89999999999994e-48 PF02801 [4346-4464]  1.70000000000001e-48 PF02801 [5913-6031]  3.99999999999998e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [564-876]  7.29999999999998e-55 PF00698 [1562-1886]  3.60000000000002e-103 PF00698 [3069-3385]  8.90000000000015e-107 PF00698 [4629-4926]  2.50000000000001e-54 PF00698 [6189-6511]  9.10000000000013e-65 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [560-861]  1.3000049540733e-69 SSF52151 [1560-1870]  2.19999900980707e-69 SSF52151 [3066-3358]  1.09999184471405e-66 SSF52151 [4625-4926]  2.39999798157263e-68 SSF52151 [6186-6492]  2.89997807423186e-70 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [695-760]  3.69999438558106e-18 SSF55048 [1690-1757]  2.10000267834031e-18 SSF55048 [3193-3258]  4.00000300869883e-17 SSF55048 [4760-4825]  3.69999438558106e-18 SSF55048 [6316-6382]  4.00000300869883e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [26-286]  G3DSA:3.40.47.10 [289-453]  G3DSA:3.40.47.10 [1037-1289]  G3DSA:3.40.47.10 [1290-1456]  G3DSA:3.40.47.10 [2540-2800]  G3DSA:3.40.47.10 [2801-2966]  G3DSA:3.40.47.10 [4086-4350]  G3DSA:3.40.47.10 [4351-4516]  G3DSA:3.40.47.10 [5654-5916]  G3DSA:3.40.47.10 [5917-6082]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [19-451]  1.39999277195148e-87 SSF53901 [1030-1402]  9.90001804798383e-101 SSF53901 [2530-2966]  5.29997329885557e-102 SSF53901 [4076-4462]  1.3000049540733e-100 SSF53901 [5647-6083]  8.00002659346736e-106 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2156-2377]  G3DSA:3.40.50.720 [3710-3895]  G3DSA:3.40.50.720 [5280-5465]  G3DSA:3.40.50.720 [7038-7221]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1191-1207]  PS00606 [2701-2717]  PS00606 [4251-4267]  PS00606 [5818-5834]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [564-869]  1.39999277195148e-110 SM00827 [1564-1867]  1.19999063421924e-125 SM00827 [3070-3367]  1.69998802370953e-120 SM00827 [4629-4934]  2.2999842048857e-110 SM00827 [6190-6492]  2.2999842048857e-116 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [947-1019]  4.00000300869883e-28 SM00823 [2444-2516]  5.20000089003336e-33 SM00823 [3990-4062]  1.50000306971104e-28 SM00823 [5563-5635]  9.90001804798395e-36 SM00823 [7327-7399]  1.99999636034521e-31 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [6560-6725]  1.59998835313644e-91 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [29-454]  SM00825 [1040-1456]  SM00825 [2540-2966]  SM00825 [4086-4516]  SM00825 [5657-6083]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2159-2338]  5.50001754266469e-50 SM00822 [3711-3888]  1.40000506907309e-50 SM00822 [5280-5459]  8.1000073432326e-58 SM00822 [7037-7217]  7.79998304125571e-57 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit
first first   FD891_00020 FD891_00020