close all open/close all

CDS information : FD891_00060


close this sectionLocation

Organism
StrainA-8890
Entry nameFD-891
Contig
Start / Stop / Direction69,921 / 71,165 / + [in whole cluster]
69,921 / 71,165 / + [in contig]
Location69921..71165 [in whole cluster]
69921..71165 [in contig]
TypeCDS
Length1,245 bp (414 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)cytochrome P450
Gene
Gene (GenBank)gfsF
EC number
Keyword
  • epoxidation
  • C-10 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[20589823] Cloning and characterization of the biosynthetic gene cluster of 16-membered macrolide antibiotic FD-891: involvement of a dual functional cytochrome P450 monooxygenase catalyzing epoxidation and hydroxylation. (Chembiochem. , 2010)
[26630077] Parallel Post-Polyketide Synthase Modification Mechanism Involved in FD-891 Biosynthesis in Streptomyces graminofaciens A-8890. (Chembiochem. , 2016)

close this sectionSequence

selected fasta
>cytochrome P450 [cytochrome P450]
MTDTTLVEAGDPAEDAPEWPMKRDTGCPFDPPPGVRKLLAEKPLSRARIWDGSTPWVVTR
HADQRALLSDPRVSHDGLRDGYPHISADFKFLSMAQPSFAGQDDPEHGRIRRMVTLPFTA
RRIEAMRPAIQKITDELIDGMLAGPKPVDLVEALALPVPVRVICEMLGVPYEDREFLQQN
NNAMIYRDTAQGDAQKAAIAQAMYLKELVGTKLGDRGDDILSDLAVQVEAGEITQDDAAG
IGMMLLGAGHETTANMIALGTLALLENPEQLAEVRDSDDPKVIVNTVEELLRYLTIAQDT
VRRIAAEDIEIGGVVIKAGEGIVFPLNAANWDPDLYPEAPDRLDIHRANARRHLAFGYGV
HQCLGATLARVELQIVYSTLLRRIPTLALAGTLDEIPFKHDQIAHGVYELPVTW
selected fasta
>cytochrome P450 [cytochrome P450]
ATGACCGACACGACACTCGTGGAAGCCGGCGACCCTGCCGAGGACGCCCCGGAGTGGCCC
ATGAAGCGGGACACCGGCTGCCCGTTCGACCCGCCGCCGGGCGTGCGGAAGCTGCTCGCC
GAGAAGCCCCTCTCGCGGGCGCGGATCTGGGACGGCAGCACGCCCTGGGTCGTCACCCGC
CACGCCGACCAGCGGGCCCTGCTCAGCGACCCGCGCGTCAGCCACGACGGCCTCCGCGAC
GGTTACCCGCACATCAGCGCGGACTTCAAGTTCCTCAGCATGGCCCAGCCGTCCTTCGCC
GGGCAGGACGACCCCGAGCACGGCAGAATCCGCCGGATGGTCACCCTGCCGTTCACGGCC
CGGCGGATCGAGGCCATGCGGCCGGCCATCCAGAAGATCACCGACGAGCTGATCGACGGG
ATGCTGGCGGGCCCCAAACCGGTCGACCTGGTGGAGGCGCTCGCCCTGCCGGTGCCGGTC
CGGGTGATCTGCGAGATGCTCGGAGTCCCCTACGAGGACCGTGAGTTCCTGCAGCAGAAC
AACAACGCGATGATCTACCGCGACACCGCTCAGGGCGACGCGCAGAAGGCCGCCATCGCG
CAGGCCATGTATCTGAAGGAGCTGGTCGGTACCAAGCTCGGCGACCGCGGCGACGACATC
CTGTCCGACCTCGCGGTGCAGGTCGAGGCCGGCGAGATCACCCAGGACGACGCCGCCGGC
ATCGGCATGATGCTGCTCGGCGCCGGACACGAGACCACCGCCAACATGATCGCGCTGGGC
ACCCTCGCCCTCCTGGAGAACCCGGAGCAACTGGCCGAGGTACGCGACAGCGACGACCCG
AAGGTCATCGTCAACACGGTCGAGGAACTGCTGCGTTATCTGACGATCGCTCAGGACACC
GTGCGCCGGATCGCCGCCGAGGACATCGAGATCGGCGGTGTGGTCATCAAGGCGGGCGAG
GGCATCGTCTTCCCACTCAACGCCGCCAACTGGGACCCGGACCTCTACCCCGAGGCCCCC
GACCGCCTCGACATCCACCGCGCCAACGCCCGCCGCCATCTGGCCTTCGGCTACGGCGTC
CACCAGTGCCTGGGCGCCACCCTGGCCCGGGTCGAGCTCCAGATCGTCTACAGCACGCTC
CTGCGCCGCATCCCCACCCTCGCCCTGGCCGGCACCCTCGATGAGATCCCCTTCAAGCAC
GACCAGATCGCCCACGGCGTCTACGAACTGCCCGTCACCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [248-265]  6.5000009155689e-07 PR00385 [285-296]  6.5000009155689e-07 PR00385 [354-363]  6.5000009155689e-07 PR00385 [363-374]  6.5000009155689e-07 PR00385
PR00385   P450
 [26-414]  9.30000048475962e-89 SSF48264
SSF48264   Cytochrome_P450
 [231-383]  1e-20 PF00067
PF00067   p450
 [28-414]  1e-97 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [102-113]  2.30000440726534e-48 PR00359 [149-165]  2.30000440726534e-48 PR00359 [166-181]  2.30000440726534e-48 PR00359 [203-225]  2.30000440726534e-48 PR00359 [285-296]  2.30000440726534e-48 PR00359 [303-330]  2.30000440726534e-48 PR00359 [354-363]  2.30000440726534e-48 PR00359 [363-374]  2.30000440726534e-48 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [356-365]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit