close all open/close all

CDS information : FD891_00070


close this sectionLocation

Organism
StrainA-8890
Entry nameFD-891
Contig
Start / Stop / Direction71,390 / 72,226 / + [in whole cluster]
71,390 / 72,226 / + [in contig]
Location71390..72226 [in whole cluster]
71390..72226 [in contig]
TypeCDS
Length837 bp (278 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)methyltransferase
Gene
Gene (GenBank)gfsG
EC number2.1.1.-
Keyword
  • C-25
Note
Note (GenBank)
Reference
ACC
PmId
[20589823] Cloning and characterization of the biosynthetic gene cluster of 16-membered macrolide antibiotic FD-891: involvement of a dual functional cytochrome P450 monooxygenase catalyzing epoxidation and hydroxylation. (Chembiochem. , 2010)
[26630077] Parallel Post-Polyketide Synthase Modification Mechanism Involved in FD-891 Biosynthesis in Streptomyces graminofaciens A-8890. (Chembiochem. , 2016)
Related Reference
ACC
Q8KI52
PmId
[12619684] Characterization of the biosynthetic gene cluster of rebeccamycin from Lechevalieria aerocolonigenes ATCC 39243. (Biosci Biotechnol Biochem. , 2003)
ACC
Q9X5Q9
PmId
[10099135] Molecular characterization and analysis of the biosynthetic gene cluster for the antitumor antibiotic mitomycin C from Streptomyces lavendulae NRRL 2564. (Chem Biol. , 1999)
[11439066] Mapping the mitomycin biosynthetic pathway by functional analysis of the MitM aziridine N-methyltransferase. (J Am Chem Soc. , 2001)
ACC
Q9S0N6
NITE
Aver_00030
PmId
[9469930] Cloning of the gene encoding avermectin B 5-O-methyltransferase in avermectin-producing Streptomyces avermitilis. (Gene. , 1998)

close this sectionSequence

selected fasta
>putative O-methyltransferase [methyltransferase]
MGPANSEGTMFDAFSREVGDYYDQANELLRAMFTDNVHYGYWPDPSSIDPLAEAGERMTE
QLYERLDVSAGHKVLDVGCGVGKPAAWLARKTGATVKGANVSRNQLEVARDRVRSEGLED
RVSFDLADAMHLPYADDSFDRIWAIESMIHMPDRDQVMREMARVLRPGGRLAIADIVVRG
TLDDVATAVVEGFCTLSTARSLEHIDNYPALVEKAGLDLLELTDVSEQTRPTGPAVLPAF
DVLLPTLGEEGVAQSKKAWGDMFDLPQYGYVLLTAGKP
selected fasta
>putative O-methyltransferase [methyltransferase]
ATGGGACCAGCGAATTCGGAGGGAACGATGTTCGACGCGTTCAGCCGCGAGGTCGGCGAC
TATTACGACCAGGCCAATGAACTGCTCCGCGCCATGTTCACGGACAACGTTCACTATGGG
TACTGGCCGGATCCGTCCAGCATCGATCCGCTCGCCGAGGCCGGTGAGCGGATGACCGAG
CAGCTCTACGAACGGCTCGACGTGAGCGCGGGGCACAAGGTGCTGGACGTGGGATGCGGC
GTAGGGAAGCCCGCCGCGTGGCTGGCCCGGAAGACGGGCGCCACCGTGAAGGGCGCCAAC
GTCAGCCGCAACCAGTTGGAGGTCGCGCGGGACCGGGTCCGCTCCGAGGGACTGGAGGAC
CGGGTCTCGTTCGATCTGGCCGACGCCATGCACCTCCCTTACGCCGACGATTCCTTCGAC
CGGATCTGGGCCATCGAGTCGATGATCCATATGCCGGACCGCGATCAGGTGATGCGTGAG
ATGGCGCGTGTCCTGCGGCCTGGCGGACGCCTGGCGATCGCCGACATCGTGGTGCGCGGA
ACCCTCGACGACGTGGCGACAGCAGTGGTGGAAGGTTTCTGCACGCTCAGCACGGCACGC
TCCCTGGAGCACATCGACAACTACCCCGCCCTGGTGGAGAAGGCCGGGCTCGACCTCCTG
GAACTCACCGATGTGAGCGAGCAGACACGGCCCACCGGACCGGCGGTCCTGCCCGCCTTC
GACGTCCTGCTGCCGACGCTCGGCGAGGAAGGCGTCGCCCAGTCGAAGAAGGCCTGGGGA
GACATGTTCGACCTGCCCCAATACGGCTACGTGCTGCTCACCGCCGGCAAACCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [75-173]  3.8e-24 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit