close all open/close all
FD891_00070 FD891_00070   last last

CDS information : FD891_00080


close this sectionLocation

Organism
StrainA-8890
Entry nameFD-891
Contig
Start / Stop / Direction73,024 / 72,293 / - [in whole cluster]
73,024 / 72,293 / - [in contig]
Locationcomplement(72293..73024) [in whole cluster]
complement(72293..73024) [in contig]
TypeCDS
Length732 bp (243 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)regulatory protein
Gene
Gene (GenBank)gfsR
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[20589823] Cloning and characterization of the biosynthetic gene cluster of 16-membered macrolide antibiotic FD-891: involvement of a dual functional cytochrome P450 monooxygenase catalyzing epoxidation and hydroxylation. (Chembiochem. , 2010)
Family/Domain
FD
IPR000792

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [regulatory protein]
MHGAAVTPPSTVSPTPVPTQSAPLSVALVSHRCPDPCEVTGFHSRRVHEPCEIRPSDDVV
LFYGPRMGQELRRFSTEANGGLPPFAVLATCLDWDDVCLALDSGAIGYLLEIEDPDLLAA
ALHCISHVHTILAPQIAEHARVTSCPGGALRQTAAVARPDTSGSATGRTGDSSPSLALSP
QEREIMTRLASGLSVREIAVEMRLAEKTVRNYLSHIYGKLGVRSRSQALLRWLGHPGGET
AHH
selected fasta
>putative LuxR family transcriptional regulator [regulatory protein]
ATGCACGGAGCAGCAGTGACACCACCCTCTACCGTCTCCCCCACCCCTGTCCCCACCCAG
TCAGCGCCCCTGTCGGTCGCGCTGGTCAGCCACCGATGCCCCGACCCCTGCGAAGTCACG
GGGTTCCACAGCAGGAGGGTCCACGAACCATGTGAGATCCGTCCGTCCGACGATGTCGTC
CTCTTCTACGGCCCGCGTATGGGCCAAGAGTTAAGGCGGTTCTCGACCGAGGCGAACGGC
GGTCTCCCGCCGTTCGCCGTCCTCGCGACCTGTCTCGACTGGGACGACGTGTGCCTCGCC
CTGGACAGCGGAGCCATCGGCTATCTGCTGGAGATCGAGGATCCGGACCTGCTCGCGGCG
GCCCTGCACTGCATATCGCACGTTCACACCATCCTCGCCCCACAGATCGCCGAGCACGCG
AGGGTCACGTCATGCCCGGGGGGCGCGCTACGGCAGACAGCGGCCGTGGCGAGACCGGAC
ACGAGCGGGAGCGCGACCGGCCGTACCGGTGATTCCTCTCCTTCCCTGGCTCTCTCGCCG
CAGGAGCGGGAGATCATGACCCGGCTGGCCTCGGGTCTCTCGGTCCGTGAGATCGCCGTC
GAGATGCGCCTGGCCGAGAAGACGGTCAGGAACTATCTCAGCCATATCTACGGAAAGCTC
GGCGTGCGAAGCCGTTCGCAGGCCCTCCTCCGCTGGCTCGGGCATCCGGGCGGTGAGACG
GCACATCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [175-232]  2.70000183580794e-21 SM00421
SM00421   HTH_LUXR
 [177-229]  4.6e-18 PF00196
PF00196   GerE
 [178-192]  6.40000038788486e-10 PR00038 [192-208]  6.40000038788486e-10 PR00038 [208-220]  6.40000038788486e-10 PR00038
PR00038   HTHLUXR
 [171-236]  PS50043
PS50043   HTH_LUXR_2
 [192-219]  PS00622
PS00622   HTH_LUXR_1
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [169-233]  2.6e-19 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [156-235]  1.99999636034521e-17 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit
FD891_00070 FD891_00070   last last