close all open/close all
first first   FR008_00020 FR008_00020

CDS information : FR008_00010


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction1,950 / 574 / - [in whole cluster]
1,950 / 574 / - [in contig]
Locationcomplement(574..1950) [in whole cluster]
complement(574..1950) [in contig]
TypeCDS
Length1,377 bp (458 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative monooxygenase
Product (GenBank)FscO
Gene
Gene (GenBank)fscO
EC number
Keyword
Note
Note (GenBank)
  • putative FAD-dependent monooxygenase
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
Related Reference
ACC
Q93NG3
PmId
[11514508] Gene cluster on pAO1 of Arthrobacter nicotinovorans involved in degradation of the plant alkaloid nicotine: cloning, purification, and characterization of 2,6-dihydroxypyridine 3-hydroxylase. (J Bacteriol. , 2001)

close this sectionSequence

selected fasta
>putative monooxygenase [FscO]
MPSTCPAPTSIGFRGCPHRRKGRTSRGRRIAVPTRPCGKVRKGHQHAKKWRVSMRGGSVA
VVGGSIAGCAAALAASRGGAERITVFERADARLRDRGVGIGVHDARYAELRDAGYMADEM
PWAPLNRRVWSVRDGDAEHGRAIGTQPFPFRAYNWGSLWSELRRRVPETATYRAGAKVEA
VEQDADGVTVRLADGEPERFDLVIGADGYRSVVREAMYPGTGAAYAGYIGWRGTSPDVSG
LPSDGLDAHNITFPGGHCMAYRIPDGSGGHRLNWVLYTAPPRIDGLHPDLRTPTSLPPGR
LNAELTEHLRALVAEHFPPFWAAKLLSTPAETTFIQPIYDLDVPHYATDRMVLIGDAASV
ARPHLGAGSVKALQDATALEAAWVAGESWKEILEGYHAARGPVGTAMVGLARRMGSAQVE
ETPDWSAMGQAEFDAWWQEQNNGSDRRSGFGGHSLKSR
selected fasta
>putative monooxygenase [FscO]
ATGCCCTCGACATGCCCGGCACCCACCTCGATAGGGTTTCGCGGGTGTCCTCACCGCAGG
AAAGGGCGGACAAGTCGGGGACGGCGGATCGCCGTTCCGACGCGCCCCTGCGGGAAAGTC
CGGAAAGGGCACCAGCACGCGAAGAAGTGGAGAGTCAGTATGCGTGGAGGCAGTGTCGCC
GTCGTCGGCGGCAGTATCGCGGGATGCGCCGCCGCATTGGCGGCGTCGCGCGGCGGGGCG
GAGAGGATCACCGTCTTCGAACGCGCCGACGCGCGACTCCGCGACAGGGGAGTGGGCATC
GGTGTCCACGACGCCCGGTACGCCGAACTGCGCGACGCCGGTTACATGGCGGACGAGATG
CCGTGGGCGCCGCTGAACCGCAGGGTGTGGAGCGTGCGCGACGGCGACGCCGAGCACGGC
AGAGCCATCGGCACCCAGCCGTTCCCCTTCCGGGCCTACAACTGGGGTTCGCTGTGGAGC
GAGTTGCGCCGCCGGGTGCCCGAGACCGCCACCTATCGGGCAGGCGCCAAGGTGGAAGCG
GTGGAGCAGGACGCCGACGGGGTCACGGTACGTCTCGCCGACGGCGAGCCGGAACGCTTC
GACCTGGTCATAGGCGCCGACGGCTACCGCTCCGTCGTCCGTGAGGCCATGTACCCGGGC
ACCGGCGCCGCGTACGCCGGCTACATCGGCTGGCGCGGGACCTCCCCGGACGTCTCCGGT
CTTCCCTCGGACGGGCTCGACGCGCACAACATCACCTTCCCCGGCGGCCACTGCATGGCC
TACCGCATCCCGGACGGCTCCGGCGGCCACCGCCTCAACTGGGTGCTCTACACGGCACCC
CCGCGGATCGACGGCCTCCACCCCGACCTGCGGACCCCCACCTCCCTGCCGCCGGGCCGG
CTCAACGCGGAACTGACGGAGCACCTGCGCGCCCTGGTGGCAGAGCACTTCCCGCCCTTC
TGGGCCGCCAAGCTCCTCTCCACCCCGGCCGAGACCACCTTCATCCAGCCCATCTACGAC
CTGGACGTGCCGCACTACGCCACCGACCGGATGGTGCTCATCGGGGACGCCGCGAGCGTG
GCCCGGCCGCACCTCGGCGCCGGCAGTGTGAAGGCACTCCAGGACGCCACCGCGCTGGAA
GCCGCCTGGGTGGCCGGGGAGAGCTGGAAGGAGATCCTGGAGGGGTACCACGCGGCTCGG
GGTCCCGTCGGCACGGCCATGGTGGGACTCGCCCGCCGGATGGGCAGTGCCCAGGTCGAG
GAGACCCCCGACTGGTCCGCGATGGGCCAGGCCGAGTTCGACGCGTGGTGGCAGGAGCAG
AACAACGGCTCCGACCGGCGCAGCGGCTTCGGCGGACACAGCCTGAAGTCCAGGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [59-408]  5.10000000000001e-11 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [58-80]  1.09999909120787e-13 PR00420 [199-214]  1.09999909120787e-13 PR00420 [348-363]  1.09999909120787e-13 PR00420 [363-379]  1.09999909120787e-13 PR00420
PR00420   RNGMNOXGNASE
SignalP
 [1-1]  Signal-anchor
Eukaryota   
 [1-31]  0.452 Signal
Bacteria, Gram-positive   
TMHMM No significant hit
first first   FR008_00020 FR008_00020