close all open/close all

CDS information : FR008_00020


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction3,037 / 2,264 / - [in whole cluster]
3,037 / 2,264 / - [in contig]
Locationcomplement(2264..3037) [in whole cluster]
complement(2264..3037) [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productaminodeoxychorismate lyase
4-amino-4-deoxychorismate lyase
Product (GenBank)PabC
Gene
Gene (GenBank)pabC
EC number4.1.3.38
Keyword
  • PABA
Note
Note (GenBank)
  • putative 4-amino-4-deoxychorismate lyase
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
[19389784] Functional characterization of the first two actinomycete 4-amino-4-deoxychorismate lyase genes. (Microbiology. , 2009)

close this sectionSequence

selected fasta
>aminodeoxychorismate lyase [PabC]
MIELDGEPAGPEALASLALTNYGHFTTLLVENGRVRGLDLHLERLIRDCRTLFDAALDPD
RVRKLARRAAPTDGRATVRVTVFDPALNLGNIAADARPGILVTSRPAPDKPPGPLRVRSV
VHRRDLPEVKSVGLCPTLRLRRQAQRAGYDDVLFTGPDGDILEGGTWNVGLVRDGEVVWP
GGEVLAGTTRQLLRRATDGPTELVGLADLDSVEAVFATNAAVGVRPVTGIDDREFPAAHH
SVTRLAEIYQALPGSPL
selected fasta
>aminodeoxychorismate lyase [PabC]
ATGATCGAACTGGACGGGGAACCCGCCGGGCCCGAGGCGCTGGCCTCGCTCGCCCTCACC
AACTACGGCCATTTCACCACGCTGCTCGTCGAGAACGGCCGGGTGCGCGGGCTCGACCTC
CACCTGGAACGCCTCATCCGCGACTGCCGGACCCTCTTCGACGCGGCGCTCGACCCGGAC
CGGGTGCGGAAGCTCGCCCGCCGGGCGGCACCAACAGACGGCCGGGCCACCGTCCGTGTC
ACCGTCTTCGACCCGGCGCTGAACCTGGGGAACATCGCCGCCGACGCCCGGCCGGGCATC
CTGGTGACCTCCCGGCCCGCCCCCGACAAGCCCCCTGGTCCGCTGCGGGTACGTTCGGTG
GTCCACCGCCGCGACCTTCCCGAGGTGAAGTCGGTCGGCCTCTGTCCCACCCTGCGGCTG
CGCAGGCAGGCCCAACGGGCGGGTTACGACGACGTGCTGTTCACGGGCCCCGACGGCGAC
ATCCTGGAGGGCGGCACCTGGAACGTCGGCCTGGTGCGCGACGGCGAGGTGGTCTGGCCC
GGCGGGGAGGTGCTGGCCGGCACGACCCGGCAGCTGCTGCGGCGGGCCACCGACGGTCCC
ACCGAACTGGTCGGCCTCGCGGACCTCGACTCAGTCGAGGCGGTCTTCGCGACCAACGCC
GCCGTCGGGGTCCGTCCCGTCACCGGCATCGACGACCGTGAGTTCCCGGCGGCCCATCAC
TCGGTGACCCGGCTCGCGGAGATCTACCAGGCACTTCCCGGCTCCCCGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001544 Aminotransferase, class IV (Family)
 [1-247]  2.50000909916183e-45 SSF56752
SSF56752   Aminotrans_IV
 [38-246]  2.2e-29 PF01063
PF01063   Aminotran_4
SignalP No significant hit
TMHMM No significant hit