close all open/close all

CDS information : FR008_00030


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction3,818 / 3,150 / - [in whole cluster]
3,818 / 3,150 / - [in contig]
Locationcomplement(3150..3818) [in whole cluster]
complement(3150..3818) [in contig]
TypeCDS
Length669 bp (222 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional regulator
Product (GenBank)FscRI
Gene
Gene (GenBank)fscRI
EC number
Keyword
Note
Note (GenBank)
  • putative transcriptional activator
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
[25575546] Production of the antibiotic FR-008/candicidin in Streptomyces sp. FR-008 is co-regulated by two regulators, FscRI and FscRIV, from different transcription factor families. (Microbiology. , 2015)
Related Reference
ACC
Q9L4V8
NITE
Nysta_00200
PmId
[14973031] In vivo analysis of the regulatory genes in the nystatin biosynthetic gene cluster of Streptomyces noursei ATCC 11455 reveals their differential control over antibiotic biosynthesis. (J Bacteriol. , 2004)

close this sectionSequence

selected fasta
>LuxR family transcriptional regulator [FscRI]
MDPAPAADPAGSPERAAVLADGFDRAGAYVACLDPSLTIQQVNQEFERRFGGSSSELCGS
RFCDLVHPSVQQPLMHQFARMLDGKRHRFATEVIAVDQERTASTLPLNALAVRGGRTPDV
AAILVVMNAAEEEAGDADVMAPRKKLLSEIDARILEGIAAGVSTIPLASRLYLSRQGVEY
HVTGLLRKLKVPNRAALVSRAYSMGVLKVGTWPPKVVEDFIK
selected fasta
>LuxR family transcriptional regulator [FscRI]
ATGGATCCCGCGCCGGCGGCCGACCCGGCCGGCTCGCCGGAACGGGCCGCCGTTCTCGCG
GACGGGTTCGACCGGGCCGGTGCCTATGTCGCCTGCCTCGACCCGTCTCTCACGATCCAG
CAGGTCAACCAGGAGTTCGAGCGCCGCTTCGGCGGCTCGTCCTCCGAACTCTGCGGCAGC
CGCTTCTGCGACCTCGTCCACCCGAGCGTCCAGCAGCCCCTCATGCACCAGTTCGCGCGG
ATGCTGGACGGCAAGCGGCACCGCTTCGCCACCGAGGTCATCGCGGTCGACCAGGAACGC
ACGGCGTCCACGCTGCCGCTGAACGCGCTCGCGGTACGCGGTGGCCGTACGCCCGACGTG
GCCGCGATCCTCGTGGTGATGAACGCCGCGGAGGAGGAGGCCGGGGACGCGGACGTCATG
GCGCCCCGCAAGAAGCTCCTCAGCGAGATCGACGCACGCATCCTGGAGGGCATAGCCGCC
GGGGTCTCGACCATCCCGCTCGCCTCCCGCCTCTACCTCAGCCGCCAGGGCGTGGAGTAC
CACGTCACCGGGCTGCTGCGGAAGCTCAAGGTGCCCAACCGTGCCGCTCTCGTCTCCCGC
GCCTACTCCATGGGCGTCCTCAAGGTCGGCACCTGGCCGCCGAAGGTCGTCGAGGACTTC
ATCAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000014 PAS domain (Domain)
 [19-93]  1.5e-06 TIGR00229
TIGR00229   sensory_box: PAS domain S-box protein
 [17-83]  0.0099 SM00091
SM00091   PAS domain
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [147-200]  1.9e-08 PF00196
PF00196   GerE
 [144-201]  3.4e-06 SM00421
SM00421   helix_turn_helix, Lux Regulon
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [130-208]  3.8e-11 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
IPR013656 PAS fold-4 (Domain)
 [23-123]  1.2e-10 PF08448
PF08448   PAS_4
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [125-211]  1.1e-12 SSF46894
SSF46894   C-terminal effector domain of the bipartite response regulators
SignalP
 [1-28]  0.091 Signal
Eukaryota   
TMHMM No significant hit