close all open/close all

CDS information : FR008_00040


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction7,205 / 4,377 / - [in whole cluster]
7,205 / 4,377 / - [in contig]
Locationcomplement(4377..7205) [in whole cluster]
complement(4377..7205) [in contig]
TypeCDS
Length2,829 bp (942 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)FscRII
Gene
Gene (GenBank)fscRII
EC number
Keyword
Note
Note (GenBank)
  • putative transcriptional regulator
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
Related Reference
ACC
Q9L4V9
NITE
Nysta_00190
PmId
[14973031] In vivo analysis of the regulatory genes in the nystatin biosynthetic gene cluster of Streptomyces noursei ATCC 11455 reveals their differential control over antibiotic biosynthesis. (J Bacteriol. , 2004)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [FscRII]
MLLERTTEIALVDAALGAATEGRSSLVLLTGPLGIGRSALLQRLSCLADDRDDVRVLRAH
AAPMEQDFAFGVVRQLFETLLGDSPEDARDRWMDAHASFARHVLADDAAPPGADQAIAAT
EAVLHGLLSLLANVSADSRLLILVDDLQWSDVPSLRWLTYLAKRLHGLRAVVVCALRDGD
PRSHHTLAREIREAGTQTLRPASLSLTATHELVREHFGEAGDDEFVQACHEASVGNPLFL
LSILVGTGFLGRRPLAEHAETARRLRPSQLRERLASILRTQPAPVRDLAAAIAILGEQSD
APTLARLAGLDSIGYAGALRALGALGALAAPDEPRFIHRSVRDAAESTLTMVQRERMHDE
AAALLYAAGSPAEQVAAQLMAVVTRRQPWAVDVLRAAADTALRRGAPDTAAGYLCRALLD
SPAAGVGRGRLLVELGTAERGFDPLACERHIAQAMTLLPEPRDRAVAALRISPTALGPAP
LTAVDLLRQAAEDLGPADGLTGTDRDLALRLEARLRHCGHEDPHELAASAHRLKELGPEP
PVDTGGERELTIALLGAATLGCHLPASEVVRLAGRVLDREPATSARIHSTLPLAIITMIA
ADSVEAVDSWLAVEHRANERGTTPANALVHIEQALVHLGRGRLAQAREQSETALGMTEPA
HQGLDTAATMTHAIVALESRDPSLAEKVLRRASRIRPQGLTLTGILRLLEATREIAAGDQ
TGALDSLHSCGRQLEAAGWHNPVLFPWRPWAVGVHRRLGDIRTARSLAEEEYARAEQWGA
PVGVGRALRLLGRLEDGGRGIGLLREAVTVLRGSANQLELARALSTLAERLGGGAETEAL
AREAATLATSCGAPGLAERAARGAGHRSGPPATPEDVLTPTERRVVGLACRGLTNQEIAG
ALGVSSRAVEKHLTHAYRRLGISGRRELIVLFSRAEYAGTGD
selected fasta
>putative LuxR family transcriptional regulator [FscRII]
ATGTTGCTGGAGCGCACCACCGAGATCGCCCTGGTCGACGCCGCCCTGGGCGCCGCGACC
GAAGGCAGGTCCTCCCTCGTCCTCCTCACCGGCCCCCTCGGCATCGGCCGCTCCGCCCTC
CTGCAGCGGCTGTCCTGCCTGGCCGACGACCGGGACGACGTCCGGGTGCTGCGGGCCCAC
GCGGCCCCCATGGAACAGGACTTCGCCTTCGGAGTCGTACGGCAGCTCTTCGAGACGCTG
CTCGGCGACTCGCCCGAGGACGCCCGGGACCGCTGGATGGACGCGCACGCCTCCTTCGCC
CGCCACGTCCTGGCCGACGACGCCGCCCCGCCCGGCGCCGACCAGGCCATCGCCGCCACC
GAGGCCGTGCTGCACGGACTGCTCTCGCTGCTCGCCAACGTGAGCGCCGACAGCCGCCTG
CTCATCCTCGTCGACGACCTGCAGTGGTCCGACGTGCCCTCGCTGCGCTGGCTCACCTAC
CTCGCCAAGCGGCTGCACGGGCTGCGGGCCGTCGTCGTCTGCGCCCTGCGCGACGGGGAC
CCCCGCAGCCACCACACCCTCGCCCGCGAGATCCGAGAGGCCGGCACCCAAACCCTGCGC
CCCGCCTCCCTCAGCCTGACGGCCACCCACGAGCTGGTCCGGGAGCACTTCGGCGAGGCG
GGCGACGACGAGTTCGTCCAGGCCTGCCACGAGGCGTCCGTCGGCAACCCGCTCTTCCTG
CTGTCGATCCTCGTCGGCACCGGCTTCCTCGGCCGCCGCCCGCTCGCCGAACACGCCGAG
ACCGCACGCCGGCTGCGCCCTTCCCAACTGCGCGAACGGCTCGCCAGCATCCTGCGCACC
CAGCCGGCCCCGGTCCGCGACCTCGCCGCCGCCATCGCCATCCTCGGCGAACAGAGCGAC
GCGCCCACCCTGGCCCGGCTGGCCGGGCTCGACTCGATCGGCTACGCGGGGGCCCTGCGC
GCCCTCGGCGCGCTCGGCGCCCTCGCCGCCCCCGACGAACCGCGCTTCATCCACCGGTCC
GTCCGCGACGCCGCCGAGTCCACCCTCACCATGGTCCAGCGGGAGCGGATGCACGACGAG
GCCGCCGCCCTCCTCTACGCCGCCGGCTCCCCGGCCGAACAGGTCGCCGCCCAGCTCATG
GCCGTCGTCACCCGGCGCCAGCCGTGGGCCGTCGACGTCCTGCGCGCCGCCGCCGACACC
GCGCTGCGCCGCGGCGCCCCCGACACCGCCGCCGGCTACCTGTGCCGCGCCCTGCTGGAC
AGCCCCGCCGCCGGCGTCGGCCGCGGCCGCCTCCTCGTCGAACTGGGCACCGCGGAGAGA
GGGTTCGACCCACTCGCCTGCGAACGCCACATCGCCCAGGCCATGACCCTGCTCCCCGAA
CCACGGGACCGGGCCGTCGCCGCCCTGCGCATCTCCCCGACCGCGCTGGGCCCCGCCCCG
CTCACCGCCGTCGACCTGCTGCGCCAGGCCGCCGAGGACCTCGGGCCCGCCGACGGGCTC
ACCGGCACCGACCGCGATCTCGCGCTCCGTCTGGAAGCCAGGCTGCGCCACTGCGGCCAC
GAGGACCCCCACGAACTCGCCGCCTCGGCGCACCGGTTGAAGGAACTGGGCCCCGAGCCC
CCGGTGGACACCGGAGGCGAGCGGGAGCTGACGATCGCGCTGCTCGGTGCCGCGACCCTC
GGCTGTCACCTGCCCGCCTCCGAGGTGGTGCGCCTCGCCGGGCGCGTCCTGGACCGCGAG
CCCGCCACCTCCGCCCGCATCCACTCCACCCTCCCGCTGGCGATCATCACGATGATCGCC
GCCGACTCGGTGGAGGCCGTCGACTCCTGGCTCGCCGTCGAGCACCGTGCCAACGAGCGG
GGTACCACCCCCGCCAACGCCCTGGTCCACATCGAGCAGGCCCTCGTCCACCTCGGGCGC
GGCCGGCTCGCCCAGGCCCGCGAGCAGTCCGAGACGGCCCTCGGGATGACGGAGCCCGCC
CACCAGGGCCTGGACACCGCGGCGACGATGACGCACGCGATCGTCGCGCTGGAGTCCCGC
GACCCCTCGCTCGCCGAGAAGGTGCTGCGGCGCGCGAGCCGCATCAGGCCGCAGGGCCTG
ACCCTCACCGGGATCCTGCGCCTGCTGGAGGCCACCCGGGAGATCGCCGCGGGCGACCAG
ACCGGAGCCCTCGACTCGCTGCACTCCTGCGGCCGCCAGCTCGAAGCCGCCGGCTGGCAC
AACCCGGTGCTCTTCCCCTGGCGCCCCTGGGCCGTCGGCGTCCACCGCCGCCTGGGTGAC
ATCCGCACCGCCCGGAGCCTCGCCGAGGAGGAGTACGCGCGGGCCGAGCAGTGGGGCGCC
CCCGTCGGGGTGGGCCGCGCGCTGCGGCTGCTCGGCCGCCTGGAGGACGGCGGCCGGGGC
ATCGGTCTGCTGCGCGAGGCCGTCACCGTGCTGCGTGGCTCCGCCAACCAGCTCGAACTG
GCCCGCGCCCTGTCCACCCTCGCCGAACGCCTGGGCGGCGGCGCCGAGACCGAGGCGCTC
GCCCGGGAGGCCGCCACCCTGGCCACCTCGTGCGGCGCCCCCGGGCTGGCCGAACGGGCG
GCCCGGGGTGCCGGTCATCGCTCCGGCCCGCCGGCCACACCGGAGGACGTGCTCACCCCG
ACCGAGCGCCGCGTGGTGGGGCTGGCCTGCCGGGGGCTGACCAACCAGGAGATCGCCGGC
GCCCTCGGGGTCAGCTCGCGCGCCGTGGAGAAGCACCTGACCCACGCCTACCGGCGCCTG
GGCATCTCCGGCCGCCGGGAACTGATCGTCCTCTTCTCCCGCGCGGAATACGCCGGCACC
GGCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [871-936]  PS50043
PS50043   HTH_LUXR_2
 [876-931]  2.1e-13 PF00196
PF00196   GerE
 [875-932]  4.60000044330862e-21 SM00421
SM00421   HTH_LUXR
 [878-892]  1.30000067202732e-05 PR00038 [892-908]  1.30000067202732e-05 PR00038 [908-920]  1.30000067202732e-05 PR00038
PR00038   HTHLUXR
IPR011990 Tetratricopeptide-like helical (Domain)
 [582-833]  1.7e-14 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [873-936]  1.4e-18 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [856-942]  7.10001443313147e-17 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit