close all open/close all

CDS information : FR008_00070


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction13,522 / 14,898 / + [in whole cluster]
13,522 / 14,898 / + [in contig]
Location13522..14898 [in whole cluster]
13522..14898 [in contig]
TypeCDS
Length1,377 bp (458 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductGDP-mycosamine glycosyltransferase
Product (GenBank)FscMI
Gene
Gene (GenBank)fscMI
EC number
Keyword
  • mycosamine
Note
Note (GenBank)
  • glycosyltransferase responsible for mycosamine attachment
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
[23324745] In vivo investigation of the substrate recognition capability and activity affecting amino acid residues of glycosyltransferase FscMI in the biosynthesis of candicidin. (Mol Biosyst. , 2013)

close this sectionSequence

selected fasta
>GDP-mycosamine glycosyltransferase [FscMI]
MDSAARPILFVSLPESGLLNPLLVLAGELARRGVPDLWFATDEHRREEVEALSDVSKVSF
ASLGEVVPELSAVTWDDEVYREVTQSSRFKAHRAVVRQSYRPALQARKYRELEQVVDEVR
PALMVVDCVAGFGVDLALARGIPYVLNVPFVASNVLTSHNPFGASYTPKSFPVPNSGLPA
RMSVRQKLANTLFKWRTLGMFLHPDMAALLREDAAIRKELGIAPPNAMTRVDEAAAVVCS
SVAELDYPFDIPDRVSLVGAVLPPLPEAPDDDEVTRWLDAQSSVVYMGFGTITRLTREEV
AALVEVARRMSGTHQFLWKLPKEQQHLLPEAGSLPDNLRVESWVPSQLDVLAHPNVSVFF
SHGGGNAYHEGVYFGKPQVVRPLWVDCFDQAVRGRDFGISLTLDKPHTVDPDDVVDKLTR
VTSDPAFRTEAERLGALQRAAGGRAAAADLVTGLLPAA
selected fasta
>GDP-mycosamine glycosyltransferase [FscMI]
ATGGACTCCGCCGCCCGGCCGATCCTCTTCGTCAGTCTCCCCGAGAGCGGGCTGCTCAAC
CCGTTGCTGGTGCTGGCCGGGGAGCTTGCCCGGCGCGGTGTGCCGGACCTGTGGTTCGCC
ACCGACGAGCACCGGCGCGAGGAGGTGGAGGCGCTCTCCGACGTCTCCAAGGTGTCGTTC
GCCTCGCTGGGCGAGGTGGTCCCCGAACTGTCGGCGGTGACCTGGGACGACGAGGTGTAC
CGCGAGGTCACCCAGTCCTCCCGCTTCAAGGCCCACCGCGCGGTCGTCCGGCAGTCCTAC
CGGCCCGCGCTCCAGGCGCGCAAGTACCGCGAGCTGGAGCAGGTCGTCGACGAGGTCCGG
CCGGCGCTGATGGTCGTCGACTGCGTCGCGGGCTTCGGCGTCGACCTGGCCCTGGCCCGG
GGCATCCCGTACGTGCTGAACGTGCCGTTCGTCGCCAGCAACGTGCTGACCTCGCACAAC
CCGTTCGGCGCCTCGTACACCCCCAAGAGCTTCCCGGTGCCCAACTCGGGGCTGCCCGCG
CGGATGTCGGTGCGGCAGAAGCTGGCCAACACGCTGTTCAAGTGGCGGACGCTCGGCATG
TTCCTGCACCCGGACATGGCGGCACTGCTGCGCGAGGACGCCGCGATACGCAAGGAACTG
GGCATCGCCCCGCCGAACGCCATGACCCGGGTCGACGAGGCCGCCGCCGTGGTGTGCTCC
TCCGTCGCGGAACTGGACTACCCCTTCGACATCCCGGACCGGGTGAGCCTGGTGGGCGCC
GTGCTGCCGCCGCTGCCCGAGGCACCGGACGACGACGAGGTCACCAGGTGGCTCGACGCG
CAGTCGTCGGTGGTCTACATGGGCTTCGGCACCATCACGCGCCTCACCCGCGAGGAGGTC
GCGGCGCTGGTGGAGGTGGCCCGGCGGATGTCCGGCACCCACCAGTTCCTGTGGAAGCTG
CCCAAGGAGCAGCAGCACCTGCTGCCCGAGGCCGGGTCGCTGCCGGACAACCTGCGGGTG
GAGAGCTGGGTGCCCTCGCAGCTCGATGTGCTGGCCCACCCGAACGTCTCCGTCTTCTTC
TCGCACGGCGGCGGCAACGCCTACCACGAGGGCGTCTACTTCGGTAAGCCGCAGGTCGTG
CGGCCCCTGTGGGTGGACTGCTTCGACCAGGCGGTCCGCGGCCGCGACTTCGGCATCAGC
CTGACCCTGGACAAGCCGCACACCGTCGACCCCGACGACGTGGTGGACAAGCTGACCCGG
GTCACCTCCGACCCCGCCTTCCGTACCGAGGCCGAACGCCTGGGCGCCCTGCAGCGGGCG
GCCGGAGGCCGTGCGGCCGCCGCCGATCTCGTGACCGGCCTGCTCCCGGCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [108-437]  1.5e-23 PF00201
PF00201   UDPGT
SignalP
 [1-26]  0.52 Signal
Eukaryota   
 [1-26]  0.153 Signal
Bacteria, Gram-negative   
TMHMM No significant hit