close all open/close all

CDS information : FR008_00080


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction14,953 / 16,011 / + [in whole cluster]
14,953 / 16,011 / + [in contig]
Location14953..16011 [in whole cluster]
14953..16011 [in contig]
TypeCDS
Length1,059 bp (352 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductGDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase
Product (GenBank)FscMII
Gene
Gene (GenBank)fscMII
EC number2.6.1.-
Keyword
  • mycosamine
Note
Note (GenBank)
  • putative aminotransferase responsible for mycosamine biosynthesis
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
Related Reference
ACC
Q93NX0
NITE
Amph_00130
PmId
[16079135] Biosynthesis of amphotericin derivatives lacking exocyclic carboxyl groups. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>GDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase [FscMII]
MAFTHPVSRPALDGRELEYVSDAVSGGWISSQGPYVRRFEEAFAEWNGVAHGVACSSGTA
ALTLALRALNIGPGDEVIVPEFTMVASAWAVTYTGATPVFVDCGDDLNIDVTRIEEKITP
RTRAVMPVHVYGRRCDMDAVMDLALQYNLRVVEDSAEAHGVRPVGDIACFSLFANKIITA
GEGGVCLTDDPRLAEQLAHLRAMAFTRDHSFLHKKLAYNYRMTAMQGAVALAQTERLDEI
LATRREIEARYDAGLKDLPGITLMPARDVLWMYDLRAERREELRAHLDARGIETRLFFKP
MSRQPGYLDPVWPTLNAHRFSEDGLYLPTHTGLTAADQEYITGAVRDFYRAG
selected fasta
>GDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase [FscMII]
ATGGCCTTCACCCATCCCGTCTCCCGGCCCGCTCTGGACGGCCGGGAACTGGAGTACGTC
TCCGACGCCGTCTCCGGCGGCTGGATCTCCTCCCAGGGACCGTACGTCCGGCGTTTCGAG
GAAGCCTTCGCCGAGTGGAACGGCGTGGCGCACGGGGTGGCCTGCTCCTCCGGCACCGCC
GCCCTCACCCTGGCGCTGCGCGCGCTGAACATCGGCCCGGGTGACGAGGTGATCGTGCCG
GAGTTCACGATGGTCGCCTCCGCGTGGGCGGTGACCTACACCGGCGCCACCCCGGTCTTC
GTGGACTGCGGCGACGACCTGAACATCGACGTCACCCGCATCGAGGAGAAGATCACTCCG
CGCACCCGGGCGGTCATGCCGGTGCACGTCTACGGCCGGCGCTGCGACATGGACGCCGTG
ATGGACCTCGCCCTGCAGTACAACCTGCGGGTGGTCGAGGACTCGGCGGAGGCGCACGGG
GTCCGCCCGGTCGGCGACATCGCCTGCTTCTCGCTCTTCGCCAACAAGATCATCACGGCC
GGCGAGGGAGGCGTCTGCCTCACCGACGATCCCCGGCTCGCCGAACAGCTGGCCCATCTG
CGGGCGATGGCCTTCACCCGCGACCACAGCTTCCTGCACAAGAAACTGGCCTACAACTAC
CGGATGACGGCCATGCAGGGCGCCGTCGCCCTGGCCCAGACCGAGCGGCTCGACGAGATC
CTCGCCACCCGCCGGGAGATCGAGGCCCGCTACGACGCGGGGCTCAAGGACCTCCCCGGC
ATCACCCTGATGCCTGCCCGCGACGTCCTGTGGATGTACGACCTGCGTGCCGAGCGCCGC
GAGGAACTCCGCGCCCACCTGGACGCACGCGGCATCGAGACCCGGCTGTTCTTCAAGCCG
ATGAGCCGCCAGCCCGGCTACCTCGACCCGGTGTGGCCGACGCTCAACGCCCACCGGTTC
AGCGAGGACGGCCTGTACCTGCCCACCCACACCGGGCTGACCGCCGCCGACCAGGAGTAC
ATCACCGGCGCCGTCCGGGACTTCTACCGCGCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-352]  2.2999842048857e-100 PIRSF000390
PIRSF000390   PLP_StrS
 [12-346]  2.09999999999996e-104 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [6-234]  2.20000000000002e-78 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [237-350]  2.6e-22 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [2-349]  4.50001022902825e-102 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit