close all open/close all

CDS information : FR008_00090


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction16,106 / 17,287 / + [in whole cluster]
16,106 / 17,287 / + [in contig]
Location16106..17287 [in whole cluster]
16106..17287 [in contig]
TypeCDS
Length1,182 bp (393 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)FscP
Gene
Gene (GenBank)fscP
EC number
Keyword
  • C-18 carboxy group formation
Note
Note (GenBank)
  • putative cytochrome P450 monooxygenase
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
[19139241] Tailoring the P450 monooxygenase gene for FR-008/candicidin biosynthesis. (Appl Environ Microbiol. , 2009)

close this sectionSequence

selected fasta
>cytochrome P450 [FscP]
MTTSPGPTVVDFPRRTPREPLPLSQYAEHRKQNGLVQTHLPNGRPIWLVTRHEDVRAVLT
HPRISANPDNEGFPNVGETMGVPKQEQIPGWFVGLDSPEHDRFRKVLIPEFTVRRVRELR
PAIERTVDERIDAMLAGGNTADLVNDFALPVPSLVISALLGVPSADRDFFESRTRTLVAI
RTSTDEERAEATRQLLRYINRLIVIKKKWRGEDLISRLLSTGKLSDEELSGVLLLLLIAG
HETTANNIGLGVVTLLSHREWIGDDRLVEELLRLHSVADMVALRVAVDDVEIAGQTIRKG
EGIVPLLASANHDTEAFGCPHAFNPERTERRHVAFGYGVHQCLGQNLVRVEMEIAYRKLF
ERIPELRLAVPEDQLAYKYDGILFGLHELPVRW
selected fasta
>cytochrome P450 [FscP]
ATGACGACCAGCCCCGGCCCGACGGTGGTCGACTTCCCACGGCGCACGCCCCGGGAACCG
CTGCCGCTGTCCCAGTACGCCGAACACCGGAAGCAGAACGGCCTGGTCCAGACGCACCTG
CCGAACGGCCGGCCGATCTGGCTGGTGACCCGGCACGAGGACGTGCGCGCGGTCCTCACC
CATCCCCGGATCAGCGCCAACCCCGACAACGAGGGCTTCCCCAACGTCGGCGAGACGATG
GGGGTGCCCAAGCAGGAGCAGATCCCCGGCTGGTTCGTCGGTCTGGACTCCCCCGAGCAC
GACCGTTTCCGCAAGGTGCTGATCCCCGAGTTCACCGTGCGCCGCGTCCGTGAGCTGCGG
CCGGCGATCGAACGGACCGTGGACGAGCGGATCGACGCGATGCTGGCCGGCGGGAACACC
GCGGACCTGGTGAACGACTTCGCGCTGCCCGTGCCGTCCCTGGTCATCTCCGCGCTGCTG
GGGGTGCCGTCGGCGGACCGGGACTTCTTCGAGTCCCGCACCCGCACGCTGGTCGCCATC
CGCACCTCGACCGACGAGGAGCGCGCCGAGGCCACCCGGCAGCTCCTGCGGTACATCAAC
CGGCTCATCGTCATCAAGAAGAAGTGGCGCGGCGAGGACCTCATCAGCCGCCTGCTGTCG
ACCGGCAAGCTCTCGGACGAGGAGCTGTCGGGCGTCCTGCTGCTCCTGCTGATCGCGGGC
CACGAGACCACGGCGAACAACATCGGGCTCGGCGTCGTCACGCTGCTCTCGCACCGGGAG
TGGATCGGCGACGACCGGCTCGTGGAGGAGCTGCTGCGCCTGCACTCGGTGGCCGACATG
GTGGCGCTGCGCGTCGCCGTGGACGACGTGGAGATCGCCGGCCAGACCATCCGCAAGGGC
GAGGGCATCGTGCCGCTGCTCGCCTCCGCCAACCACGACACCGAGGCGTTCGGCTGCCCG
CACGCCTTCAACCCGGAGCGCACCGAGCGCCGTCACGTGGCGTTCGGCTACGGCGTCCAC
CAGTGCCTGGGCCAGAACCTGGTCCGGGTCGAGATGGAGATCGCCTACCGCAAGCTCTTC
GAGCGCATCCCGGAGCTGCGGCTGGCCGTGCCCGAGGACCAGCTCGCCTACAAGTACGAC
GGGATCCTGTTCGGGCTGCACGAGCTGCCGGTGCGCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [239-256]  6.7e-08 PR00385 [266-277]  6.7e-08 PR00385 [333-342]  6.7e-08 PR00385 [342-353]  6.7e-08 PR00385
PR00385   P450
 [26-260]  3.7e-05 PF00067 [267-362]  7.5e-19 PF00067
PF00067   p450
 [13-393]  3.6e-88 SSF48264
SSF48264   Cytochrome P450
 [17-393]  7.8e-96 G3DSA:1.10.630.10
G3DSA:1.10.630.10   no description
IPR002397 Cytochrome P450, B-class (Family)
 [95-106]  7.5e-44 PR00359 [142-158]  7.5e-44 PR00359 [159-174]  7.5e-44 PR00359 [197-219]  7.5e-44 PR00359 [284-311]  7.5e-44 PR00359 [312-327]  7.5e-44 PR00359 [333-342]  7.5e-44 PR00359 [342-353]  7.5e-44 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [335-344]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit