close all open/close all

CDS information : FR008_00110


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction17,556 / 18,413 / + [in whole cluster]
17,556 / 18,413 / + [in contig]
Location17556..18413 [in whole cluster]
17556..18413 [in contig]
TypeCDS
Length858 bp (285 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Producttype II thioesterase
Product (GenBank)FscTE
Gene
Gene (GenBank)fscTE
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • type II thioesterase
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
[18836004] Selective removal of aberrant extender units by a type II thioesterase for efficient FR-008/candicidin biosynthesis in Streptomyces sp. strain FR-008. (Appl Environ Microbiol. , 2008)

close this sectionSequence

selected fasta
>type II thioesterase [FscTE]
MPRPARPSHPRTRRRRNTDRRQNHRRDSPVTTADDTAARWLRRYHPAEADAVRLVCFPHA
GGSASFYHPVSARFAPGAEVVSLQYPGRQDRRKEPCVPDLGTLADLITEQLLPLDERPTV
FFGHSMGAALAFETAWRLEQKGAGPRTVIASGRRGPSTTRAERVHTRDDDGIVAEMKRLN
GTAAGVLGDEEILRMALPALRGDYRAIETYTCPPDRRLACGLTVLTGEDDPLTTVEEAER
WRDHTTGPFRLRVFTGGHFFLTQHLDAVNTEIAQALHPDRAAPAA
selected fasta
>type II thioesterase [FscTE]
GTGCCCCGTCCGGCCCGGCCCTCGCACCCGCGGACCCGTCGCCGGCGGAACACCGACCGG
CGCCAGAACCATCGAAGGGACTCCCCCGTGACCACCGCTGACGACACCGCGGCCCGCTGG
CTGCGGCGGTACCACCCGGCCGAGGCCGACGCGGTACGGCTGGTGTGCTTCCCGCACGCC
GGCGGCTCCGCCAGCTTCTACCACCCGGTCTCGGCGCGGTTCGCGCCGGGCGCCGAGGTC
GTCTCGCTCCAGTACCCGGGCCGGCAGGACCGCCGCAAGGAGCCCTGTGTCCCGGACCTC
GGCACGCTGGCCGACCTGATCACCGAGCAGCTGCTCCCGCTGGACGAGCGGCCCACCGTC
TTCTTCGGGCACAGCATGGGGGCCGCGCTCGCCTTCGAGACGGCGTGGCGGCTGGAGCAG
AAGGGCGCCGGTCCCCGCACCGTCATCGCCTCCGGACGGCGCGGCCCCTCCACCACCCGC
GCCGAACGGGTCCACACGAGGGACGACGACGGGATCGTCGCGGAGATGAAGCGGCTGAAC
GGCACGGCGGCCGGTGTCCTCGGCGACGAGGAGATCCTCCGCATGGCGCTGCCCGCGCTG
CGCGGCGACTACCGCGCCATCGAGACCTACACCTGCCCTCCGGACCGCCGGCTGGCCTGC
GGGCTGACCGTGCTGACGGGCGAGGACGACCCGCTGACCACCGTCGAGGAGGCGGAGCGG
TGGCGCGACCACACCACCGGGCCGTTCCGGCTGCGGGTCTTCACGGGCGGGCACTTCTTC
CTCACCCAGCACCTCGACGCGGTCAACACGGAGATCGCCCAGGCCCTCCACCCCGACCGG
GCCGCCCCGGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [53-276]  1.40000000000001e-62 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit