close all open/close all

CDS information : FR008_00120


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction18,610 / 20,781 / + [in whole cluster]
18,610 / 20,781 / + [in contig]
Location18610..20781 [in whole cluster]
18610..20781 [in contig]
TypeCDS
Length2,172 bp (723 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative aminodeoxychorismate synthase
putative 4-amino-4-deoxychorismate synthase
Product (GenBank)PabAB
Gene
Gene (GenBank)pabAB
EC number2.6.1.85
Keyword
  • PABA
Note
Note (GenBank)
  • putative glutamine amidotransferase and horismate binding enzyme
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
Related Reference
ACC
P32483
PmId
[11782498] The candicidin gene cluster from Streptomyces griseus IMRU 3570. (Microbiology. , 2002)
ACC
P72539
PmId
[9044253] Identification and analysis of genes from Streptomyces pristinaespiralis encoding enzymes involved in the biosynthesis of the 4-dimethylamino-L-phenylalanine precursor of pristinamycin I. (Mol Microbiol. , 1997)
ACC
Q56151
PmId
[8704974] A role for pabAB, a p-aminobenzoate synthase gene of Streptomyces venezuelae ISP5230, in chloramphenicol biosynthesis. (Microbiology. , 1996)

close this sectionSequence

selected fasta
>putative aminodeoxychorismate synthase [PabAB]
MRTLLVDNYDSFTYNLFHYLSRANGREPEVIRNDDPAWRPGLLDAFDNVVLSPGPGTPHR
PADFGLCARIAEEGRLPVLGVCLGHQGMALAHGARVGRAPEPRHGRTSAVRHDGTGLFEG
LPQPLEVVRYHSLAVTELPPELEATAWSEDGVLMALRHRTLPLWGVQFHPESIGTQDGHR
LLANFRDLTERHGRTRPGGRAGHGTLPPPAPARETTATTGTPRRLRVIAESLPTRWDAEV
AFDSLFRTGDHPFWLDSSRPGGELGQLSVMGDASGPLARTAKADVHAGTVTVRADGASST
VESAFLTWLENDLAGLRTEVPELPFAFALGWVGCLGYELKAECDGDAAHRSPDPDAVLVF
ADRALVLDHRTRTTYLLALVEDDAEAEARAWLAAASATLEAIAGREPEPCPEAPVCTTGP
VELRHDRDGYLKLIDVCQQEIAAGETYEVCLTNMAEADTDLTPWAAYRALRRVSPAPFAA
FLDFGPMAVLSSSPERFLRIDRHGRMESKPIKGTRPRGATPQEDAALVRALATCEKDRAE
NLMIVDLVRHDLGRCAEVGSVVADPVFQVETYATVHQLVSTVTARLREDSSPVAAVRAAF
PGGSMTGAPKIRTMQIIDRLEGGPRGVYSGAIGYFSLTGAVDLSIVIRTVVLSGGRLRYG
VGGAVIALSDPADEFEETAVKAAPLLRLLDTAFPGREAPGKDLDGEPDDGTDAGAPKDLV
LPG
selected fasta
>putative aminodeoxychorismate synthase [PabAB]
ATGCGCACCCTTCTCGTCGACAACTACGACTCGTTCACCTACAACCTCTTCCACTACCTC
TCCCGGGCCAACGGCCGGGAACCCGAGGTCATCCGCAACGACGACCCGGCCTGGCGGCCC
GGTCTGCTCGACGCGTTCGACAACGTGGTGCTCTCCCCGGGGCCGGGTACCCCACACCGC
CCGGCCGACTTCGGCCTGTGCGCCCGGATCGCCGAGGAGGGCCGGCTGCCGGTGCTCGGC
GTCTGCCTGGGCCACCAGGGCATGGCCCTCGCCCACGGCGCCCGGGTGGGCCGGGCCCCC
GAGCCCCGTCACGGCCGCACCTCGGCGGTACGGCACGACGGCACCGGGCTCTTCGAGGGG
CTGCCGCAGCCGCTGGAGGTGGTGCGGTACCACTCCCTCGCGGTGACGGAACTGCCGCCG
GAGCTGGAGGCCACCGCCTGGTCGGAGGACGGGGTCCTGATGGCGCTGCGCCACCGCACG
CTGCCGCTGTGGGGGGTGCAGTTCCACCCCGAGTCGATCGGCACCCAGGACGGCCACCGG
CTGCTGGCCAACTTCCGCGACCTCACCGAGCGCCACGGCCGAACGCGCCCGGGCGGCCGG
GCGGGGCACGGCACGCTCCCGCCCCCCGCGCCCGCCCGGGAGACGACGGCCACCACCGGC
ACGCCACGGCGGCTCCGGGTCATCGCCGAGTCGCTGCCCACGCGCTGGGACGCCGAGGTC
GCCTTCGACTCGCTGTTCCGCACCGGCGACCACCCCTTCTGGCTCGACAGCAGCCGTCCC
GGGGGCGAGCTGGGCCAGCTCTCCGTGATGGGCGACGCCTCAGGTCCCCTCGCCCGGACC
GCCAAGGCCGACGTGCACGCCGGAACGGTCACGGTGAGAGCCGACGGCGCCAGCAGCACG
GTCGAGAGCGCCTTCCTGACCTGGCTGGAGAACGACCTGGCGGGGCTGCGCACCGAGGTG
CCCGAACTTCCCTTCGCGTTCGCGCTCGGCTGGGTCGGCTGCCTGGGCTACGAGTTGAAG
GCCGAGTGCGACGGCGACGCCGCGCACCGCTCACCCGATCCCGACGCCGTGCTGGTCTTC
GCCGACCGGGCCCTGGTGCTGGACCACCGCACCCGCACCACCTACCTGCTGGCGCTGGTG
GAGGACGACGCCGAGGCCGAGGCACGCGCCTGGCTCGCGGCGGCCTCCGCCACCCTGGAG
GCCATCGCCGGGCGGGAGCCCGAGCCGTGCCCCGAGGCGCCCGTGTGCACGACGGGTCCG
GTGGAGCTGCGCCACGACCGGGACGGCTACCTGAAGCTGATCGACGTCTGCCAGCAGGAG
ATAGCCGCCGGGGAGACCTACGAGGTCTGCCTGACCAACATGGCCGAGGCGGACACCGAC
CTCACCCCGTGGGCGGCCTACCGCGCGCTGCGCCGGGTGAGCCCCGCCCCGTTCGCCGCG
TTCCTGGACTTCGGCCCCATGGCCGTGCTCAGCAGCTCTCCGGAGCGGTTCCTGCGCATC
GACCGGCACGGGCGGATGGAGTCCAAGCCGATCAAGGGCACGCGGCCACGCGGCGCCACC
CCGCAGGAGGACGCCGCGCTCGTACGCGCCCTGGCCACCTGCGAGAAGGACCGCGCCGAG
AACCTGATGATCGTCGACCTGGTCCGCCACGACCTGGGGCGGTGCGCCGAGGTCGGCTCG
GTCGTCGCCGACCCGGTGTTCCAGGTCGAGACGTACGCGACCGTGCACCAGCTGGTCAGT
ACCGTCACGGCGCGGCTGCGCGAGGACAGCAGCCCGGTGGCGGCGGTCCGGGCGGCCTTC
CCCGGCGGATCGATGACCGGGGCGCCGAAGATCCGCACCATGCAGATCATCGACCGGCTG
GAAGGCGGGCCGCGCGGTGTCTACTCGGGCGCCATCGGCTACTTCTCCCTCACCGGCGCG
GTGGACCTGTCCATCGTGATCCGCACGGTGGTGCTCAGCGGCGGCAGGCTGCGCTACGGC
GTCGGCGGCGCCGTCATCGCGCTCTCCGACCCGGCCGACGAGTTCGAGGAGACGGCGGTC
AAGGCCGCCCCGCTGCTGCGTCTCCTCGACACCGCCTTCCCGGGCCGTGAGGCTCCCGGC
AAGGACCTCGACGGGGAACCCGACGACGGCACGGACGCGGGTGCTCCGAAGGACCTCGTC
CTGCCCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005801 ADC synthase (Domain)
 [224-691]  G3DSA:3.60.120.10
G3DSA:3.60.120.10   TRPE_1_chor_bd
 [221-699]  1.70001788822269e-129 SSF56322
SSF56322   TRPE_1_chor_bd
IPR005802 Para-aminobenzoate synthase, component I (Family)
 [331-685]  TIGR00553
TIGR00553   PabB
IPR006221 Anthranilate synthase/para-aminobenzoate synthase, glutamine amidotransferase (Family)
 [4-185]  1.09999999999999e-49 TIGR00566
TIGR00566   TrpG_papA
IPR006805 Anthranilate synthase component I, N-terminal (Domain)
 [241-376]  2.6e-17 PF04715
PF04715   Anth_synt_I_N
IPR015890 Chorismate binding, C-terminal (Domain)
 [427-681]  4.89999999999996e-87 PF00425
PF00425   Chorismate_bind
IPR017926 Glutamine amidotransferase type 1 (Domain)
 [4-185]  3.29999999999997e-49 PF00117
PF00117   GATase
 [2-195]  PS51273
PS51273   GATASE_TYPE_1
SignalP
 [1-25]  0.091 Signal
Eukaryota   
TMHMM No significant hit