close all open/close all

CDS information : FR008_00130


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction20,927 / 26,158 / + [in whole cluster]
20,927 / 26,158 / + [in contig]
Location20927..26158 [in whole cluster]
20927..26158 [in contig]
TypeCDS
Length5,232 bp (1,743 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)FscA
Gene
Gene (GenBank)fscA
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)

close this sectionPKS/NRPS Module

0
1 malonyl-CoA
A51..463
PCP569..648
KS666..1042
AT1204..1526
ACP1590..1663

close this sectionSequence

selected fasta
>polyketide synthase [FscA]
MVPVHAHDYVTDPPSTTGRTLDGLTLPRVFADAVHRGGDAVALVDGEYALTWSAWRTAVD
ALARGLQESGVVSGDVVALHLPNSWEYLTLHLAAASVGAVTMPVHQGNAPSDVRALLERV
RPAAVVLPARTQEGGGPLTGTALREVLPELRAVLVTGDAAGEGTETVTEMLERWSGEDPL
PVEVRPDSPFLLLPSSGTTSARPKICLHSHEGLLTNSRAATEDTADAYAGTLITACPLTH
CFGLQSAYSALFRAGRQVLLSGWDVGRFLELARRERPSVVVAVPAQLHDLVTRVREDADG
PGFRPGRILTAGAALPPALVRDVREALDTTLVVVWGMSEAGNGTSSLSADAPEVVSRSVG
RPTRDAEMRVVDEDGAPCPPGQPGELYYRSPSMFRGYFGEPELTRSVVSEDGWLRTGDLA
SIGEDGLVTFHGRSAELINVGGRKFNAVEIQALLADLPDIGPLAVVAAPDPRLGEYPVLV
VTERPAAAPADGTAPRPRGTVGLDEVTAHLRGLGTAEYKIPLELVALPELPRTPAGKINR
RALEQYLADAAERTAVTPAEAPRPGLRTALELVVTAVAEVLAAVPGEDGARPAAAGPIGP
DTTFRAHGLDSVASVRLRNALAEATGLTLPAGLAFDFPTPAALARELAGLSSPAAEESPG
ASAHEDEPVAIVSMACRLPGGATSPEALWELLRDGVDAVSGFPEDRGWDLDALFGDDPDA
PGTSVAREGGFLRDAAHFDAGFFGMSAREALATDPQQRLLLETAWEAVERAGIAPRTLRG
SRTGVFTGAMYHDYAAGASDPAGELESLLPVGTAGGALSGRIAYTLGLSGPALTVDTACS
SSLVALHLACRSLRSGESDLALAGGVAVMATPAAFVGFSRLRGLSPDGRCKSFGEGADGA
AWSEGAGLLMLERLSDARRNGHPVLAVIRGSAVNQDGASNGLTAPHGPAQRRVVRQALAD
AGVRAAEVDVVEAHGTGTALGDPIEAEALLDTYGRDRPEGRPLWLGSVKSNLGHTQAAAG
AAAVIKMVLALRHDLLPATLHADTPTSRVDWSPGTVQLLTRARDWPREEGRPRRAGVSSF
GISGTNAHLVLEEAPVPAAGTERSADAGAAGLRAAVPWLVSAKDADALRGQARRLAAHAA
AHPEVSARDLAYSLLTTRALHPRTALLTGGDRDALVASADAFARGEAPGSIVRGPLGPAP
GTAFVLTGQGSQRLGMGRGLAAAFPVFDDALREVCALLDPLLERPLTEVMWAAPDSDEAG
LLGGTGYAQPALFAFEVALYRLLESWGIVPDRLVGHSVGEIAAAHVAGVLSLPDACALVA
ARGRLMQALPPGGAMAAVRCSEAEILPLLAGRTAGATVAAVNGPRSVVLSGTEEAVAEVV
TEVSAAGHKTRRLMVSHAFHSPLMEPMLAEFRATVAGLSFAAPQVPLVSGVTGRPLTAEE
ARDPDHWVRHARDTVRFADAISHLAGEHTEIYVELGPEAALTPMVEECLGEPESGDGPAV
EPVVRGDVDEERAALAAAVRLHALGLDVQWRAVLPEARAVPLPTYAFQHEAYWLATSGSV
VAGLSLPGGRAADTVPDLAGRLAGLSGGEAEALVTELVRTELAAVTGGEISAAGAGTAFT
ELGVTSVTAVELRNRLTAVTGVRLPPTLIFDHPTPTAVARLIGETVRGSSVPGRRDAVSL
VDELEALLVSGAEVDSDTAARLRSLAGRWAPSATGTAADANGPLDLDDASDEELFRLMDG
GAP
selected fasta
>polyketide synthase [FscA]
ATGGTGCCCGTCCACGCACACGACTACGTGACCGATCCGCCCTCCACCACCGGCAGGACC
CTGGACGGGCTGACGCTGCCACGGGTGTTCGCCGACGCCGTACACCGGGGCGGCGACGCC
GTGGCCCTGGTGGACGGGGAGTACGCCCTGACCTGGAGCGCCTGGCGGACGGCGGTGGAC
GCGCTGGCGCGCGGCCTCCAGGAGTCCGGCGTCGTCTCCGGCGACGTGGTGGCCCTGCAC
CTGCCCAACAGCTGGGAGTACCTGACGCTCCATCTGGCCGCCGCCTCGGTCGGGGCGGTC
ACGATGCCGGTGCACCAGGGCAACGCTCCCTCGGACGTCCGGGCCCTGCTGGAACGGGTC
CGGCCCGCAGCCGTCGTCCTGCCGGCGCGGACCCAGGAGGGTGGGGGCCCGCTCACCGGC
ACGGCGCTGCGCGAGGTCCTGCCCGAGCTGCGCGCCGTGCTCGTCACGGGCGACGCGGCG
GGCGAGGGCACCGAGACGGTGACCGAGATGCTGGAGCGGTGGTCCGGAGAGGACCCGCTG
CCCGTCGAGGTGCGCCCGGACTCGCCGTTCCTGCTGCTGCCGTCCTCGGGCACCACCTCG
GCGCGGCCCAAGATCTGCCTCCACTCGCACGAGGGGCTGCTCACCAACTCCCGGGCCGCC
ACCGAGGACACCGCGGACGCCTACGCCGGCACCCTGATCACCGCGTGCCCCCTGACCCAC
TGCTTCGGCCTCCAGTCGGCGTACTCGGCGCTCTTCCGCGCCGGCCGCCAGGTGCTGCTG
TCCGGGTGGGACGTCGGCCGGTTCCTGGAGCTGGCCCGCCGGGAGCGGCCCAGCGTGGTG
GTGGCGGTCCCCGCCCAACTGCACGACCTGGTCACCCGGGTGCGCGAGGACGCGGACGGC
CCCGGCTTCCGGCCCGGCCGGATCCTCACCGCCGGAGCGGCCCTGCCCCCGGCGCTCGTC
CGCGACGTGCGGGAGGCGCTGGACACCACGCTGGTGGTGGTGTGGGGCATGTCGGAGGCC
GGCAACGGCACCAGCAGCCTCTCCGCCGACGCGCCGGAGGTGGTCTCCCGCAGCGTCGGC
CGGCCCACCCGCGACGCCGAGATGCGCGTCGTGGACGAGGACGGCGCCCCGTGCCCGCCC
GGGCAGCCCGGCGAGCTGTACTACCGCAGTCCCAGCATGTTCCGTGGCTACTTCGGCGAG
CCGGAGCTGACCCGGTCGGTGGTGTCGGAGGACGGCTGGCTGCGCACCGGCGACCTCGCC
TCGATCGGCGAGGACGGCCTGGTCACCTTCCACGGCCGGTCGGCCGAACTGATCAACGTC
GGCGGCCGCAAGTTCAACGCGGTGGAGATCCAGGCGCTCCTCGCGGACCTGCCGGACATC
GGCCCGCTCGCCGTGGTCGCCGCGCCGGACCCGCGTCTGGGCGAGTACCCGGTCCTGGTG
GTCACCGAACGGCCGGCCGCCGCACCGGCGGACGGCACGGCACCGCGCCCGCGCGGCACG
GTCGGGCTCGACGAGGTGACGGCTCATCTCCGGGGCCTGGGCACCGCCGAGTACAAGATT
CCGCTGGAGCTGGTGGCCCTTCCCGAGCTGCCCCGCACTCCCGCGGGGAAGATCAACCGG
CGGGCGCTGGAGCAGTACCTCGCCGACGCCGCCGAGCGGACCGCCGTTACTCCCGCCGAG
GCGCCGCGCCCCGGTCTCCGGACGGCGCTGGAGCTGGTGGTGACCGCCGTCGCCGAGGTG
CTGGCCGCCGTGCCCGGCGAGGACGGCGCGCGGCCCGCCGCCGCCGGTCCGATCGGGCCG
GACACCACCTTCCGCGCCCACGGTCTGGACTCGGTCGCCTCCGTACGGCTGCGCAACGCG
CTCGCCGAGGCCACGGGGCTGACGCTGCCCGCCGGACTCGCCTTCGACTTCCCCACCCCG
GCCGCCCTGGCCCGGGAACTGGCCGGGCTCTCCTCCCCGGCCGCAGAGGAGAGCCCGGGT
GCGTCCGCCCACGAGGACGAGCCCGTCGCGATCGTCTCCATGGCCTGCCGCCTGCCCGGC
GGCGCCACCTCCCCCGAGGCGCTGTGGGAGCTGCTGCGCGACGGCGTCGACGCCGTGTCC
GGCTTCCCCGAGGACCGGGGCTGGGACCTGGACGCCCTCTTCGGCGACGACCCCGACGCA
CCGGGCACCTCGGTGGCGCGCGAGGGCGGGTTCCTGCGCGACGCGGCCCACTTCGACGCC
GGCTTCTTCGGGATGTCCGCGCGGGAGGCCCTCGCCACCGACCCGCAGCAGCGGCTGCTG
CTGGAGACGGCCTGGGAGGCCGTGGAGCGCGCCGGCATCGCCCCGCGAACCCTGCGGGGC
AGCCGTACCGGTGTGTTCACCGGCGCGATGTACCACGACTACGCGGCCGGCGCGTCCGAC
CCGGCCGGGGAGCTGGAGAGCCTGCTGCCGGTGGGCACCGCGGGCGGCGCGCTCTCCGGG
CGGATCGCCTACACCCTCGGGCTGAGCGGTCCGGCGCTCACCGTGGACACCGCCTGCTCC
TCCTCGCTGGTCGCCCTGCACCTCGCCTGCCGCTCCCTGCGCTCCGGCGAGTCGGACCTG
GCGCTGGCCGGCGGCGTCGCCGTGATGGCCACCCCGGCCGCGTTCGTGGGCTTCTCCCGG
CTGCGGGGCCTTTCCCCCGACGGCCGCTGCAAGTCCTTCGGCGAGGGAGCCGACGGAGCC
GCCTGGTCGGAGGGGGCCGGCCTGCTCATGCTGGAGCGGCTCTCCGACGCCCGCCGCAAC
GGCCACCCTGTCCTCGCGGTGATCCGCGGCTCCGCCGTCAACCAGGACGGCGCCTCCAAC
GGACTGACCGCCCCCCACGGGCCGGCCCAGCGCCGGGTCGTCCGGCAGGCCCTGGCCGAC
GCCGGTGTCCGCGCCGCCGAGGTGGACGTGGTCGAGGCGCACGGAACCGGTACCGCCCTC
GGCGACCCCATCGAGGCCGAGGCGCTGCTCGACACCTACGGACGGGACCGGCCGGAGGGC
CGTCCGCTGTGGCTGGGTTCGGTGAAGTCCAACCTGGGACACACGCAGGCCGCCGCCGGC
GCCGCCGCCGTGATCAAGATGGTGCTGGCCCTGCGGCACGACCTGCTCCCGGCCACCCTG
CACGCCGACACCCCCACCTCCCGGGTGGACTGGTCCCCCGGCACCGTGCAGCTGCTGACG
CGGGCCCGCGACTGGCCCCGCGAGGAGGGCAGGCCGCGCCGCGCGGGCGTCTCGTCCTTC
GGCATCAGCGGCACCAACGCCCACCTCGTCCTGGAGGAGGCACCCGTGCCCGCCGCCGGC
ACGGAGCGGAGCGCGGACGCGGGAGCCGCCGGCCTCCGTGCCGCCGTGCCGTGGCTGGTG
TCGGCCAAGGACGCGGACGCGCTGCGCGGCCAGGCCCGGCGCCTGGCCGCACACGCCGCC
GCCCACCCGGAGGTGTCCGCACGCGACCTCGCCTACTCCCTGCTCACCACCCGGGCGCTG
CACCCCCGCACCGCCCTGCTGACCGGCGGCGACCGGGACGCGCTGGTCGCGTCCGCCGAC
GCCTTCGCCCGTGGCGAGGCACCCGGGAGCATCGTCCGTGGCCCGCTCGGTCCCGCCCCC
GGGACCGCCTTCGTCCTCACCGGGCAGGGCAGCCAGCGGCTCGGCATGGGGCGCGGGCTC
GCCGCCGCCTTCCCGGTCTTCGACGACGCTCTGCGCGAGGTGTGCGCGCTCCTCGACCCG
CTGCTGGAACGGCCGCTGACCGAGGTCATGTGGGCCGCGCCGGACAGTGACGAGGCGGGG
CTCCTCGGCGGCACGGGCTACGCCCAGCCCGCGCTCTTCGCGTTCGAGGTCGCCCTGTAC
CGGCTTCTGGAGTCGTGGGGGATCGTCCCCGACCGGCTGGTGGGGCACTCGGTCGGCGAG
ATCGCCGCCGCCCACGTGGCCGGGGTGCTCTCCCTGCCGGACGCCTGCGCCCTGGTCGCC
GCGCGGGGGCGGCTGATGCAGGCGCTGCCGCCGGGCGGCGCCATGGCGGCGGTGCGCTGC
TCCGAGGCGGAGATTCTGCCGCTCCTGGCCGGACGCACCGCCGGGGCCACCGTCGCCGCC
GTCAACGGCCCGCGGTCCGTGGTGCTGTCGGGCACCGAGGAGGCCGTGGCCGAGGTCGTC
ACGGAGGTCTCCGCCGCCGGGCACAAGACGCGTCGGCTCATGGTCAGCCACGCCTTCCAC
TCGCCGCTGATGGAGCCGATGCTCGCGGAGTTCCGGGCGACGGTCGCCGGGCTGTCGTTC
GCCGCGCCCCAGGTTCCGCTGGTCTCCGGCGTCACCGGACGGCCGCTCACCGCCGAGGAG
GCCCGCGACCCGGACCACTGGGTACGCCATGCCAGGGACACCGTCCGCTTCGCCGACGCG
ATCAGCCATCTTGCCGGAGAACACACCGAGATCTACGTCGAGTTGGGCCCGGAGGCCGCA
CTCACCCCGATGGTCGAGGAGTGCCTGGGCGAGCCGGAGAGCGGCGACGGTCCCGCCGTG
GAGCCGGTGGTACGGGGCGACGTGGACGAGGAGCGGGCGGCACTGGCCGCCGCCGTACGG
CTGCACGCGCTCGGCCTGGACGTGCAGTGGCGGGCGGTGCTGCCGGAGGCCCGCGCGGTG
CCGCTGCCGACCTACGCCTTCCAGCACGAGGCCTACTGGCTGGCCACGTCCGGTTCCGTG
GTCGCGGGGCTGTCGCTGCCGGGCGGCCGGGCGGCCGACACCGTTCCGGACCTGGCCGGG
CGGCTGGCGGGGCTCTCCGGCGGTGAGGCGGAGGCGCTCGTCACCGAACTGGTGCGGACC
GAGCTGGCGGCGGTGACCGGTGGTGAGATCTCCGCCGCCGGAGCCGGCACGGCCTTCACC
GAGCTGGGCGTCACCTCCGTCACGGCGGTGGAGCTGCGCAACCGGCTGACCGCCGTCACC
GGCGTGCGGCTTCCCCCGACCCTGATCTTCGACCACCCCACCCCCACGGCCGTGGCCCGC
CTCATCGGCGAGACGGTCCGGGGGAGTTCGGTCCCGGGCCGCCGGGACGCCGTGTCCCTG
GTGGACGAGTTGGAGGCGCTGCTCGTCTCGGGCGCCGAGGTCGACTCGGACACGGCGGCG
CGGCTGCGGTCCCTGGCCGGCCGGTGGGCTCCGTCGGCCACCGGAACGGCGGCCGACGCG
AACGGTCCGCTGGATCTGGACGACGCCTCCGACGAGGAGCTGTTCCGCCTCATGGACGGC
GGCGCCCCGTGA
[0] A51..463
[0] PCP569..648
[1] KS666..1042
[1] AT1204..1526
[1] malonyl-CoA1397..1401
[1] ACP1590..1663
[0] A151..1389
[0] PCP1705..1944
[1] KS1996..3126
[1] AT3610..4578
[1] malonyl-CoA4189..4203
[1] ACP4768..4989

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [51-464]  3.90000000000001e-77 PF00501
PF00501   AMP-binding
IPR001227 Acyl transferase domain (Domain)
 [1199-1329]  7.20000000000002e-73 G3DSA:3.40.366.10 [1397-1514]  7.20000000000002e-73 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR009081 Acyl carrier protein-like (Domain)
 [566-683]  1.60000240695997e-20 SSF47336 [1585-1670]  9.90001804798395e-18 SSF47336
SSF47336   ACP_like
 [576-647]  1.6e-09 PF00550 [1597-1662]  2.1e-09 PF00550
PF00550   PP-binding
 [574-649]  6.70000000000001e-32 G3DSA:1.10.1200.10 [1594-1665]  6.70000000000001e-32 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [569-648]  PS50075 [1590-1663]  PS50075
PS50075   ACP_DOMAIN
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [666-917]  9.39999999999981e-91 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [925-1042]  8.39999999999997e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [1204-1526]  2.70000000000002e-60 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [1201-1491]  1.19999063421924e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [1331-1396]  7.49999605851445e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [669-929]  5.40000000000002e-87 G3DSA:3.40.47.10 [930-1095]  9.69999999999989e-65 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [659-1041]  3.79997359309399e-101 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [830-846]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [1205-1507]  1e-122 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [574-651]  1.10000150671642e-21 SM00823 [1595-1666]  1.60000240695997e-27 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [669-1096]  SM00825
SM00825   PKS_KS
IPR025110 Domain of unknown function DUF4009 (Domain)
 [518-545]  3.5e-05 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit