close all open/close all

CDS information : FR008_00140


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction26,333 / 27,340 / + [in whole cluster]
26,333 / 27,340 / + [in contig]
Location26333..27340 [in whole cluster]
26333..27340 [in contig]
TypeCDS
Length1,008 bp (335 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance ABC transporter ATP-binding protein
Product (GenBank)FscTI
Gene
Gene (GenBank)fscTI
EC number
Keyword
Note
Note (GenBank)
  • putative ABC transporter
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
Related Reference
ACC
Q9F5K4
NITE
Avil_00350
PmId
[11181344] An ATP-binding cassette transporter and two rRNA methyltransferases are involved in resistance to avilamycin in the producer organism Streptomyces viridochromogenes Tu57. (Antimicrob Agents Chemother. , 2001)
ACC
Q53716
PmId
[8326867] Streptomyces antibioticus contains at least three oleandomycin-resistance determinants, one of which shows similarity with proteins of the ABC-transporter superfamily. (Mol Microbiol. , 1993)

close this sectionSequence

selected fasta
>putative drug resistance ABC transporter ATP-binding protein [FscTI]
MNGLHLPPAPLPAPGVSAAGSGDLMIEAEGVSKAYGTVHALDSVSLAVPRGTVLGLLGHN
GAGKTTLVDILTTALPPTSGRARVAGYDVADKPVEIRRRIGLTGQFASVDAQLSGYDNLV
LIARLLGAGRRAARVRARELLELFRLTEVADRRASSYSGGLRRRLDLAVSLVGAPEVLFL
DEPTTGLDPSSRINLWEIVEGLVEQGTTVLLTTQYLEEADRLADRIAVLSAGRVVAAGTA
PELKATVGRRTVTLTLETGEDVSAARTALRGAGFAPVDGEARTVVVPIDATREIADIIRS
LDQAGVEASELNFGEPTLDDVYLTLAEQAAGRTRA
selected fasta
>putative drug resistance ABC transporter ATP-binding protein [FscTI]
ATGAACGGGCTCCACCTGCCCCCCGCCCCCTTGCCCGCCCCGGGCGTGAGCGCCGCCGGT
TCCGGCGATCTGATGATCGAGGCGGAGGGCGTCAGCAAGGCATACGGCACGGTCCACGCC
CTGGACTCGGTCAGCCTCGCCGTCCCCCGGGGCACCGTGCTGGGACTCCTCGGCCACAAC
GGCGCCGGGAAAACCACCCTGGTCGACATCCTCACCACGGCGCTGCCGCCCACCTCGGGG
CGGGCGAGGGTCGCCGGGTACGACGTGGCCGACAAGCCGGTCGAGATCCGCCGGCGCATC
GGGCTCACCGGGCAGTTCGCCTCGGTGGACGCGCAGCTCAGCGGGTACGACAACCTCGTC
CTGATCGCCCGTCTGCTGGGCGCCGGGCGCCGGGCGGCCCGCGTGCGCGCGAGGGAGCTG
CTGGAGCTGTTCCGGCTGACGGAGGTCGCGGACCGGCGTGCGAGCAGCTACTCGGGCGGG
CTGCGGCGGCGCCTGGACCTGGCCGTGTCGCTGGTCGGCGCGCCGGAGGTGCTCTTCCTC
GACGAGCCCACCACCGGCCTGGACCCCTCCAGCCGCATCAACCTGTGGGAGATCGTCGAG
GGGCTGGTCGAGCAGGGCACCACGGTGCTGCTGACCACGCAGTACCTGGAGGAGGCCGAC
CGGCTGGCGGACCGGATCGCGGTGCTCTCCGCGGGCCGGGTCGTCGCGGCGGGCACGGCG
CCCGAGCTGAAGGCCACCGTGGGGCGCCGCACGGTGACGCTCACCCTGGAGACCGGCGAG
GACGTGAGCGCGGCGCGCACGGCGCTGCGCGGGGCGGGCTTCGCCCCGGTCGACGGCGAG
GCCCGCACCGTGGTCGTCCCGATCGACGCCACACGGGAGATCGCCGACATCATCAGGAGC
CTGGACCAGGCCGGCGTCGAGGCGAGCGAGCTGAACTTCGGCGAACCCACGCTCGACGAC
GTGTACCTGACCCTCGCCGAGCAGGCCGCCGGCCGGACCCGGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [65-185]  4.2e-16 PF00005
PF00005   ABC_tran
 [26-256]  22.116 PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [50-233]  8.6e-09 SM00382
SM00382   ATPases associated with a variety of cellula
IPR005894 Daunorubicin resistance ABC transporter ATP-binding subunit (Family)
 [33-325]  4.5e-99 TIGR01188
TIGR01188   drrA: daunorubicin resistance ABC transporter, ATP
SignalP
 [1-18]  0.412 Signal
Bacteria, Gram-positive   
TMHMM No significant hit