close all open/close all

CDS information : FR008_00150


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction27,561 / 28,280 / + [in whole cluster]
27,561 / 28,280 / + [in contig]
Location27561..28280 [in whole cluster]
27561..28280 [in contig]
TypeCDS
Length720 bp (239 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance ABC transporter permease protein
Product (GenBank)FscTII
Gene
Gene (GenBank)fscTII
EC number
Keyword
Note
Note (GenBank)
  • putative ABC transporter
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
Related Reference
ACC
O86917
PmId
[9696745] A silent ABC transporter isolated from Streptomyces rochei F20 induces multidrug resistance. (J Bacteriol. , 1998)
ACC
Q53717
PmId
[8326867] Streptomyces antibioticus contains at least three oleandomycin-resistance determinants, one of which shows similarity with proteins of the ABC-transporter superfamily. (Mol Microbiol. , 1993)

close this sectionSequence

selected fasta
>putative drug resistance ABC transporter permease protein [FscTII]
MVTDPGIVLFGLIQPVVILFVLTQVFSKMGMPPHFPDGVSYLDYVLPAVLVDNAAQSAMQ
SGVGLVEDQKNGIVARLRSLPVHPGALLAARSLVGLVRSAVQVAVIMALAMTVLGYSPNG
GAAELALSAGLTLFISFSLGWAFIAAGAWLRRAEPLQNLALIVIFPLMFASSAYVPVADL
PSWLGAVASVNPLTYAIDATRALALDVPGLDHAIPAVVICAVIAVVGMIAAVRGFRRPL
selected fasta
>putative drug resistance ABC transporter permease protein [FscTII]
ATGGTGACCGACCCGGGCATCGTGCTCTTCGGCCTGATCCAGCCGGTGGTCATCCTCTTC
GTGCTGACCCAGGTCTTCAGCAAGATGGGTATGCCGCCCCACTTCCCGGACGGCGTCAGC
TACCTCGACTACGTCCTGCCCGCCGTCCTGGTGGACAACGCCGCCCAGTCGGCGATGCAG
TCGGGCGTGGGCCTGGTGGAGGACCAGAAGAACGGCATCGTGGCCCGGCTGCGCTCCCTG
CCCGTCCACCCGGGCGCGCTGCTGGCCGCCCGCAGCCTGGTCGGCCTGGTGCGCAGCGCC
GTGCAGGTCGCGGTCATCATGGCGCTGGCGATGACCGTCCTCGGCTACTCCCCCAACGGC
GGTGCCGCCGAACTGGCCCTCTCCGCGGGGCTGACGCTCTTCATCAGCTTCTCGCTGGGC
TGGGCGTTCATCGCGGCCGGCGCCTGGCTGCGGCGGGCCGAGCCGCTGCAGAACCTCGCC
CTGATCGTGATCTTCCCGCTGATGTTCGCCTCCAGCGCCTACGTCCCGGTCGCGGACCTG
CCCTCCTGGCTGGGCGCGGTCGCGAGCGTCAACCCCCTGACGTACGCGATCGACGCGACC
CGGGCACTGGCGCTGGACGTGCCCGGCCTGGACCACGCGATCCCGGCGGTGGTGATCTGC
GCCGTGATCGCGGTGGTCGGCATGATCGCCGCCGTACGCGGCTTCCGCCGGCCTCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000412 ABC-2 (Family)
 [6-238]  PS51012
PS51012   ABC_TM2
IPR013525 ABC-2 type transporter (Domain)
 [5-203]  5.09999999999998e-28 PF01061
PF01061   ABC2_membrane
IPR013526 ABC-2 transporter (Family)
 [8-29]  1.69999922284049e-09 PR00164 [88-113]  1.69999922284049e-09 PR00164 [162-181]  1.69999922284049e-09 PR00164 [182-201]  1.69999922284049e-09 PR00164
PR00164   ABC2TRNSPORT
SignalP
 [1-27]  0.36 Signal
Bacteria, Gram-positive   
 [1-27]  0.66 Signal
Eukaryota   
TMHMM
 [5-27]  Transmembrane (o-i) [95-117]  Transmembrane (i-o) [127-149]  Transmembrane (o-i) [156-178]  Transmembrane (i-o) [213-235]  Transmembrane (o-i)
Transmembrane 5