close all open/close all

CDS information : FR008_00160


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction60,860 / 28,983 / - [in whole cluster]
60,860 / 28,983 / - [in contig]
Locationcomplement(28983..60860) [in whole cluster]
complement(28983..60860) [in contig]
TypeCDS
Length31,878 bp (10,625 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)FscC
Gene
Gene (GenBank)fscC
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)

close this sectionPKS/NRPS Module

5 malonyl-CoA
6 malonyl-CoA
7 malonyl-CoA
8 malonyl-CoA
9 malonyl-CoA
10 malonyl-CoA
KS35..410
AT578..891
DH940..1102
KR1417..1593
ACP1694..1764
KS1788..2162
AT2320..2633
DH2682..2849
KR3155..3335
ACP3436..3506
KS3530..3904
AT4061..4373
DH4419..4585
KR4884..5060
ACP5161..5231
KS5254..5628
AT5777..6091
DH6139..6300
KR6590..6770
ACP6872..6942
KS6966..7334
AT7492..7809
DH7857..8019
KR8331..8511
ACP8616..8686
KS8809..9171
AT9333..9644
DH9692..9857
KR10183..10363
ACP10467..10537

close this sectionSequence

selected fasta
>polyketide synthase [FscC]
MASSEAKLRDYLKKVTTDLRRTRQRLETVEARESEPIAVIGMACRFPGGVRSPEDLWQLV
ADGTDAIGPLPADRGWDLDGLYDPDPGTPGKSYVREGGFLEGAADFDADLFGIAPREALA
MDPQQRLLLETAWEAVERARISPASLRNTDTGVFVGGADTNYGSLARTAEETEGHNLTGG
AMSVLSGRISYTLGLEGPAVTVDTACSSSLVALHLAVRALRAGECSLALAGGVAMMPTTE
LFTEFSRQRGLATDGRCKPFAEAADGTSWGEGVGVLLVERLSDARRNGHPVLAVVRGTAV
NQDGASSRLTAPNGPSQRRVIEAALADARLAADQVDAVEAHGTGTTLGDPIEAQALLATY
GQNRPEDRPLRLGGIKSNIGHAQAAAGVAGVIKMVMAIRHGLLPATLHVDTPTPHVDWTA
GAVELLTEAVDWPDADRPRRAGVSAFGISGTNAHVLLEQATPEPAGAEDTPQDATPAEPV
TATDPAVTPWLLSARSQTALRAQAARLLAHLTDHTGPESPRPADIALSLATSRAPLPHRA
VVLATDPGTTEAALTSLAADEPHPAVLEDAVRSASTAFLFSGQGSQRLGMGRGLYERFPV
FAEAFDAVCAGLDEHLERPLREVVWGDDTSVLDGTAYAQAGLFAVEVALFRLVESWGVRP
EFVAGHSIGEVAAAHVAGVFSLADACVLVAARGRLMQALPEGGAMVAVEASEAEVLPRLE
SVEGVSVAAVNGPSSVVVSGAEDAVEAVAEVFREQGRRVSRLRVSHAFHSPLMEPMLGDF
REALAGLSYAEPSLPVVSNVSGRIAEPGELTTPDYWVRHVREAVRFDDGVQALAAEGVAR
FVELGPDGVLSGMARVSAGEDAVLVPLLRKDRDEEVTALAALGRLHATGAPVDWTAVLAG
TGARLVDLPTYAFQHEHYWPVPAPAPAGDVESAGLRAAGHPLLSAAVELSDSGGLLLTTR
LSLRTHPWLGEHVVMGNALLPGTAFVELAVRAGDEVGCDRVEELTLAAPLVLPEQGGVQL
HLHVGPADAAGRRVLAARSRAEGADDQPWTEHATGVLAPGERTVEFDTSVWPPADAESLD
LTGLYERMAEGGYRYGPLFQGLRAAWRRGDDVFAEVALPDSAERDATAYGLHPALLDASL
HVSALGGLAHGVVPFSWEGVCLHATGAREVRVRMTRTGDETVTVAVADPTGAPVASVENL
VLRRVAPDATGVDALTRDALFRVDWVRTEAPGDAAGTGPVGVLGDSDASTALAGVLRADG
LSDGGFVAFPDLEDLAAAEEVPATVLVRVRPDAATRPDAVVDAVHALAARGLELVREWLA
QERFTDSRLVFVTSDAVDGGDLADAALRGLVRSAVSEHPGRFGLMEVGRGTDTATVLAAV
ATGEPETAARDGEVLAPRLARITSGTTTGPRWDSIDGTVLLTGGTGGLGRIVARHLVVER
GVRDLLLVSRSGAAADGAGQLVAELSETGAHVTVEACDVSDPAAVAELVARHPVRAVVHS
AGVLDDGTVESLTAERVTRVLRPKADAAWNLHEATRALDLEAFVVFSSMSGILGGPGQAN
YAAGNTFLDALVRHRRSLGLPATSLAWGPWTQDAGMIGTLSGTSRHRVARAGMPELTAEQ
GTALFDAALASGEPVVLPVRLDLAALRGQGDLHPMMLGLVRRRGRRAAAGGSVAAAGLVQ
RLGALGVDERREVLLDLVRGQVAVVLGHAGVQSVDPGRAFQDLGFDSLTAVELRNRLGKS
TGLRLPATVVFDYPTVNALVGYLLEELFGGVEPASVVPVSALPSVAEDPIVIVGMACRYP
GGVSSPEDLWTVVSEGVDTVSEFPVNRGWDVDALYNPDRDASGTTYTKAGGFLHDAGAFD
SEFFGMSPREAVATDSQQRLLLETTWEAIERSGIDPASLRGSQTGVFAGVMYNDYGNMLA
DERYEGFRSNGSAPSIASGRVSYTFGFEGPAVTVDTACSSSLVALHWAAQALRSGECSLA
VAGGVTVMSTPTTFVEFSRQGGLSADGRCRSFADSADGVGWSEGVGMVVLERLSDARRNG
HRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALASGGLSAGDVDVVEAHGTGTTLG
DPIEAQALLATYGQEREEGRPLWLGSVKSNLGHTQAAAGVAGVIKMVMAMRHGRLPRTLH
VDAPSSHVDWSAGAVELLTGERVWPGEERLRRAGVSSFGISGTNAHVILEQPEPVAEPET
GGDGIAALAPGIVPWVLSGRTEEALRAQAARLLAQVEGHPGLRPVDLALSLATQRSLFDH
RAVVLTDDRETAVRGLAAVCVGEPDPAVVLGAVEPGRTAFLFSGQGSQRLGMGRGLYERF
PVFAEAFDAVCAGLDAHLDRPLREVVWGDDTSVLDGTAYAQAGLFAVEVALFRLVESWGV
RPEFVAGHSIGEVAAAHVAGVFSLADACVLVAARGRLMQALPEGGAMVAVEASEAEVLPR
LESVEGVSVAAVNGPSSVVVSGAEEAVEAVAEVFRELGRRVSRLRVSHAFHSPLMEPMLD
AFHEVLRDLSFAEPRLPVVSNVSGRIAEPGELTAPDYWVRHVREAVRFDDGVRALAEEGV
TRFVELGPDGVLSGMARASAGEDAVLVPLLRKDREEVAVALSALAELHVRGVSAGWGAVL
DGTGGRAVDLPTYAFQHEHYWPTGTTTGTGDIRLAGLGAAGHPLLGAAVELAGADGLILT
GRLSTRSHPWLADHVVQGAVLVPGTALLEMAVRAADEAGCGSVEELTLSAPLVLPERGAV
RVQVGVGEPDESGRRTVAIHSRDDGDERQPWSLHAQGVLAPETIDADPAAEGFDASVWPP
RDAVPVDVTDCYESLAEAGLRYGPVFQGLRAAWRRDDEVFAEVALPDGVDATAFGLHPAL
FDAALHASFAFGGDDAPGGVPFVWENATLHASGASVLRTRLTRTGDDTLAVHVADPTGAP
VASVGSLTVRAAAGARAADTAEPLYRVEWVPARGTRATPAAGSVVLLGEGLADLAGDGAA
VRADLQELAAAEAVPETVVVAVPPAPDTEGVVGSAHASAAWALALVKEWLAQERFAGSRL
VFITRGGHVTEPASALTSAPVRGLVRSVALEHPGRFGLLHLPAGTDAGRLFAALAVDEPE
TAVLDSEVCVPRLVRTTPDAGGEETAGSSAGLGSGTVLLTGGTGGLGRIVARHLVVERGV
RDLLLVSRSGAAAEGVDAFTAELTGLGARVSVAACDLADRTALDALLAGVPADRPVRAVV
HAAGVLDDGMAESLTAERVAAVLRPKVDAAWNLHEATRGLDLEAFVVFSSVAGTFGSAGQ
GAYAAGNVFLDALVEYRRSLGLPGVSLVWGPWAQDAGMTRGLSETDRRRIARSGLPPVEA
EQGTALFDAALASGEPVVLPVRLDLAALRGEEDVPALFRGLVRRRGRRAAAGGSVAAAGL
VQRLGALGVDERREVLLDLVRGQVAVVLGHAGVQSVDPGRAFQDLGFDSLTAVELRNRLG
KSTGLRLPATVVFDYPTVNALVGYLLEELFGGVEPAAVVPVSALPSVAEDPIVIVGMACR
YPGGVSSPEDLWRVVSEGVDTVSDFPSDRGWDVDALYNPDRAVPGTSYTRSGGFLHDAPE
FDPEFFGMSPREAVSTDAQQRLLLETTWEAIERSGIDPVSLRGSQTGVFAGVMYHDYANL
LASPEYEGYQGSGSAGSVASGRVSYTFGFEGPAVTVDTACSSSLVALHWAAQALRSGECS
LAVAGGVTVMSTPSTFVEFSRQGGLSADGRCRSFADSADGVGWSEGVGMVVLERLSDARR
NGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALASGGLSAGDVDVVEAHGTGTT
LGDPIEAQALLATYGQGRDEERPLLLGSVKSNIGHTQAAAGVAGVIKMVMAMRHGRLPRT
LHVDAPSSHVDWSAGAVELLTGERVWPGEERARRAGVSSFGISGTNAHVILEQPEPVTGS
GPGEADGTEASSGVQPWVLSARTEEALRAQAARLADFLTDAPADVRDVALSLATQRTLFD
HRAVVLGADLETALTSLRALAAGAPDAAVAEGVAGNGRTAFLFPGQGSQRLGMGRDLYER
FPVLAEAFDAVCAELDEHLDRPLREVVWGDDAELLNRTAYAQPGLFAVEVALFRLVESWG
VRPEFVAGHSIGEVAAAHVAGVFTLADAAALVAARGRLMQALPEGGAMAAVEATCAEVLP
HLTGNLSIAAVNGPSSVVVSGSEASVESVAEVFRELGRRVSRLRVSHAFHSPLMEPMLHA
FREVVEGLSFAAPRIPLVSNITGTLAEPGQVDEPEYWVTHVREAVRFDDGVRALAEEGVT
RFVEVGPDGVLSGMARESAGEDAVLVPLLRKDREETGSALSALGRLHTVGVDVDWSGFLV
GARPVDLPTYAFQKQRYWPEATLPRAGDVRFAGLGSAGHPLLGAAVELAGADGADGVVLT
GRLSTRSHPWLADHVVQGTVLVPGTALLEMAVRAADEAGCGSVEELTLSAPLVLPERGAL
QIQIRVAAPDEDGRRALGVHARTEDDDGAPWTVHATGTLAPETLAPDPFDATVWPPRDAA
QVDVTDCYERLAEAGFAYGPAFRGLRAAWRHGDALYAEVALDGGTDGDAFGLHPALFDAA
LHAFALADDGRGGVPFSWGGVSLHASGATALRVRLTRDADGTMALALADPAGSPVATVHS
LTVRPLATGQLTTPARDSLYQVEWVPARPLDGPADTGAVAVLGEARSAVPAADDFVTYAT
LEELAAAEEMPSTVLVAASDDADGTDPAQAAHTAAARALALVRSWLAEDRFAGSRLVFVT
ASTDRTTGLADAAARGLVRSAISEHPGRFGLLELPADADTASLRSALASGEAESVVRDGE
VRVPRLARVTPEATEGLRWDALTGPVLITGGTGGLGRVLARHLVMTHGVRDLLLVSRSGA
NAEGAGELVTELTEAGAHVAVEACDAADADAVAGLVTRHGVRAVVHAAGVIDDATLASLT
AERVAAVLRPKVDAAWNLHEATRDLGLEAFVVFSSVAGTFGSAGQGAYAAGNVFLDALVE
YRRALGLPGVSLVWGPWAQDAGMTRELSETDRRRIARSGLPPVEAEQGTALFDAALASGE
PVVLPVRLDLPALRAQGEVPPLLSGLIRTSVRRTAAAAGAAATGLAARLAGLAEAERREV
LLDLVRGQIAVVLGHSGAQTVNPHRAFQDLGFDSLTAVELRNRLGKVTGLRLPATVVFDY
PTADLLAGHLLDGVLGTEPAVAVPVAALPSVADDPVVIVGMACRYPGGVTSPEDLWSVVS
DGVDAVGDFPSDRGWDVESLYSEDRGVPGTTYTRSGGFLHDAPEFDPEFFGMSPREAVST
DAQQRLLLETTWEAIERSGIDPVSLRGSQTGVFAGVMYNDYGSILTDDQYEGYRGNGSAG
SIASGRVSYTFGFEGPAVTVDTACSSSLVAMHWAAQALRSGECSLAVAGGVTVMATPTAF
VEFSRQGALSPDSRCKAFSDAADGAGWSEGVGMVVLERLSDARRNGHRVLAVVRGSAVNQ
DGASNGLTAPNGPSQQRVIRQALASGGLSAGDVDVVEAHGTGTTLGDPIEAQALLATYGQ
GRDEERPLLLGSVKSNIGHTQAAAGVAGVIKMVMAMRHGRLPRTLHVDAPSSHVDWSAGA
VELLTGERVWPGEERLRRAGVSSFGISGTNAHVILEQPEEAQEPAPTVAPAVDVPWVLSA
RSAPALRAQAERLRVHVAAEPVSAPDVAFSLVSGRATFDHRAVVLGTDREAALEALASGL
PDAGVVEGVATGGRTAFLFSGQGSQRLGMGRGLYERFPVFAEAFDAVCAGLDEHLERPLR
EVVWGDDTSVLDGTAYAQAGLFAVEVALFRLVESWGVRPEFVAGHSIGEVAAAHVAGVFT
LADAAALVAARGRLMQALPEGGAMVALEASEAEVLPRLESVEGVSVAAVNGSSSVVVSGA
EDAVEAVAEVFREQGRRVSRLRVSHAFHSPLMEPMLGDFREVLSGLSYAEPSLPVVSNVS
GRIAEPGELTTPDYWVTHVREAVRFDDGVRALAEEGVTRFVELGPDGVLSGMAREGAGED
AVLVPLLRKDREETSTALAALARLHTVGAEVKWTGFFAGTAARTVDLPTYAFQKRRFWPE
TTVRAAADPRSAGVDAADHPLLGAVVSLPDSGGVVLTGRLSVEAQPWLADHVVLGRVLLP
GTGLVELALAAGDAAGSTALEELTLAAPLVLPEDTGLQLRVVAGPKTDGRRTVAVHSRPE
GAEDAPWTAHAHGFLTDAPAGSGEALTEWPPPGADPVPVEHAYEEFRHRGYGYGPVFQGL
RAAWRRDDAMFAEVALPEDAAGEAGRFGLHPAVLDAAMHAGILNEEEGQAVVPFAWNDVT
LHAVGASAVRVRVSRVDAHTVSLTLADSTGAPVLTVGSLASRPVSAEQLGSASAGAGALY
GIEWTPVTVDTSTAPAHVSWAEALEADTTAPGAVVLEVREPAGPDVPAAVRAVLDQVLPA
IQQWLRDERFTSSRLVVVTRGAAPAGSSADVVQAPVWGLVRAALAENPGRFALADVSVDA
DDAAVDRAVAAALSGEAEVAVRDGVVLVPRLSRLAEPELPLSVPSLDGEGAVLVTGGTGG
LGAVMARYLVAERGVRDLVLVSRRGGDAPGAAELAGELREAGAAVEVVACDLSDRESVVG
LVESLVAGRGLRAVVHAAGVGGGGLVGTLSSDRFDAVLGAKADAAWWLHEATAGVELAAF
VLVSSAGGLVLTAGQGNYAAANVFLDALASRRRAEGLVATSMAFGFWDVGAGLGEYLSEV
DRRRMASQGLPLLSHEAGLELFAAGLDRGEATVVPLRVDTAALRTRTDEIPALLKSLAPV
RRSAAVVPPATVEGSPAHRLASLPEAERHRTLLHLVRSQVAAVLGHGSAEAIGADRAFQE
LGFDSLAATELRNQLNTLTGLRLPATLVFDHPNALAVTDHLSARLAGESARAETPVRTGT
AAPADDEPIAIVGMACRYPGGVTTPEELWRLVTDGVDTVSDLPGDRGWDIEGLYDPEPGK
EGKSYTRRGSFLHDAAQFDPGFFGISPREALYMDPQQRLLLETSWEALERAGIDPATLRG
SRTGVFAGVMYHDYALNVSPSGTAGGSVVSGRLSYTFGWEGPAVTVDTACSSSLVALHLA
VQALRSGECSLAVAGGATVMSTPGMFVEFSRQRGLSVDGRCKAFAGAADGVGWSEGVGVL
LVERLSDAVRNGHRVLAVVKGTAVNQDGASNGFTAPNGPSQQRVIRQALHGAGVPASEVD
VVEAHGTGTTLGDPIEAQALLATYGQDRPEDRPLLLGSVKSNIGHAQAAAGVAGVIKMVM
AMEHGTVPRTLHVDRPSPHVDWTEGRAELVTEDRPWPVTGRPRRASVSAFGLSGTNAHVV
LEQGPDAAADAPSTAEEGRAPAVLPWTVSAATPDALRAQATRLLDHLADRPGTRPLDVAH
ALATSRTPLEARAVVLGTGRDDLLTGLRALAAGEHAPGVITGTARSVGTTAFLFSGQGAQ
RLEMGRGLHEAFPVFAEAFDAVCAGLDEHLDRPLREVAWGENAPDLDGTAYAQSALFAYE
VALFRLLASWGVTPDLVAGHSIGEVAAAHVAGVFSLADACALVAARGRLMQALPEGGAMV
AVEASETEVLPHLESVEGVSVAAVNGPSSVVVSGAGEAVEAVAEVFREQGRRVSQLRVSH
AFHSPLMEPMLADFREVLSGVSYAEPSLPVVSNVSGRIAESGELATPDYWVTHVREAVRF
GDGVRALRAAGVDRCVEIGPDAVLTGMARTCLDGDEDTAVLLVPSARKGREEPDALLTAL
AQLHTAGTAVDWAGFFAGSGAGPVDLPTYAFQRQRYWLTATDGAPAAAGAGLDAADHPLL
GAVVSLPDSGGAVLTGLLSVEAQPWLADHVVLGRVMLPGAVLVELALAAGESVDCAVLDE
LTLATPLVLPEHGGAQVRVVVGPRTAERRTVAVYSRPEGTGQEWATHATGFLTDNALVAG
AEAALEQWPPTGAASVPVDSAYQIFRERGYGYGPVFQGLRAAWRRGGELFAEVALPEEAA
SEAGRFGLHPALLDAAMHVAILNDSNDSNDSNDNAEGGSGGTVIPFAWNRVALHAVGAAA
VRVRIATAADGGMDIRVTDVTGAPVLTVGSMVSRTVSAGQLGAAPRDAGALYAPEWVPVT
RLDDTDTAWATWSRVEEAGTEVPAVVVLDASAPAGADVPGSVRSALDGVLTVAQRWLTEE
RFAASRLVVVTRGAMPVGSGGAPAEGDVVQAPVWGLVRAALAENPGRFALADVAVDADDA
AVDCAVAAVLSGEAEVAVRDGVVLVPRLTRLTADAPAAELPLSVPSLDGEGAVLVTGGTG
GLGAVMARYLVAERGVRDLVLVSRRGGDAPGAAELAGELREAGAAVEVVACDLSDRESVV
DLVGSLVSGRGLLAVVHAAGVGDNGLLGSLTPDRFDAVLGAKADAAWWLHEATAGVELAA
FVLVSSAGGLVLTAGQGNYAAANVFLDALASRRRAEGLVATSMAFGFWDVGAGLGEYLSE
VDRRRMASQGLPLLSHEAGLELFAAGLDRSEATVVPLRVDTAALRTRTDEIPALLRALAP
ARRATAASGSAAAPGPDDSPSRRLAELPAPERHRAVLHLVRSQVAAVLGHGSAEAIGADR
AFQELGFDSLAATELRNQLNTLTGLRLPATLVFDHPNALAVTEVVEEELAAAHPASGAGG
ATGDDDGVRRALSAIPARRLRDAGLAETLLELAADSDEMSDTDRDALLAAFDGDDEDDAS
GPYDESDGAAETAGTGTATEPGADALRAARAETARLRRDNRRLTSAQHEPIAIVGMACRY
PGGVSSPEDLWRLVTSGDDAIVPFPQDRGWDLSILRDPDGDHPDGLYAREGGFLDGAADF
DPAFFGISPREALGMDPQQRLALEMSWEALERAGIDPASLKGSRTGVFTGVMYHDYPGSD
GNGSVVTGRVAYKLGLEGPAVSVDTACSSSLVALHLAVQALRQGECSLAVTGGVTVLSTP
AVFAEFGRQGGLAPDGRCKSFASAADGTGFSEGAGFLVVERLSDAVRNGHEVLAVVRGSA
VNQDGASNGLTAPNGPSQRRVIRQALANARLAADQVDAVEAHGTGTTLGDPIEAQALLAT
YGQDRPEDRPLLLGSVKSNIGHAQAAAGVAGVIKMVLALRNGLLPATLNVDAPSDQVDWT
TGSVELLTEARQWTGSGRPRRAGISSFGISGTNAHVIVEQAPAAVPSDEPATGADDDGVA
PVVPWLLSARDRDALRAQAERLLHHLTGDHPAAGGTEARPLDVAYSLATARTAFEHRVAV
TGAGRDGLLAALGSVARGEEPATTTGEGLLALLFPGQGSQRLGMGRDLYERFPVFAEAFD
AVCAGLDAHLDRPLREVVWGDDEDALNATAYAQAALFALGVGLHRLVASWGVTPDLVAGH
SIGEIAAAHVAGVFSLADACALVAARGRLMQALPEGGAMAAVQATEDEVLAHLTDGVSVA
AVNGPTSVVVSGTAEGVEKVTEALRERGRRTTALRVSHAFHSPLMEPMLAEFRAVVAGLS
PQAPVIPVVSNLTGTTARAEELCSAEYWVRHVREAVRFADGVRALHEAGATRYLELGPDG
VACAMARESLPESAVTVAAQRRTVPGEQALVEAVARLHGHGVRVDWPAFFAGRGARRVEL
PTYAFQRRRFWPAGMMPLGAGAEAAGLAPAGHPLLGGAVELAGTDGHLFTGRLSQGTHGW
ISDHRVMGAVLVPGTALLELAVHAGGVLGCDVVEELTLAAPLVLPEQGTVQVQVGVGAPD
EEGRRGITIHSRPADDSGAPWTSHAEGTLAAGPAQAPATDFDATVWPPEKAEPLDTTGLY
ERFEDAGFAYGPVFQGLRAAWSRDGEVFAEASLPDGTDGDAFTLHPALFDAGLHATALAG
DGGESEGTGGVPFSWNGVSVHAVGASSVRLRLSRTDDGTLAIAVTDTAGTPVASVGSLVT
RPLSAGQFGGAGGAGRDSLFQLDWAAAGDPATRDAETPGPVAVLGPDTALLGGGDLLAEA
GTEGVTGLADLVTGTGPGEDVPSVVLLPVATAPEAGSGTGDVAAAAHAATARVLETLRDW
SAQERFAASRLVVVTRGASDGADPAAAAVWGLVRAAQAENPGRFILLDLEPSATSPLGMS
ALRAALASGEPQLALREDRLLAPRLVRAVTPAESDAAGWDPEGTVLITGGTGGLGATVAR
HLVAEHGVRSLLLVSRRGPAAEGAGELAAALEESGAHVTVAACDVGDRTAVDALLAEIPA
DRPLRAVIHAAGVLDDGVLDSLTPERLAAVLRPKADAAWHLHEATEGLTLDAFVLFSSVA
GTLGSAGQANYAAGNAFLDALARHRRDRGLPAVSMAWGPWTRGSGMTGELTEADTARMAR
AGMPPIDPEQGLALFDAVTGAAEQAPAVLPVRLDLGALRSLGEVPPLFRSLIRTQARRAA
SDGGAAAAADLTRRLTGLTRTEGEEVLLDLVRGQIATVLGHAGQADIEPARAFQDLGFDS
LTSVELRNRLGALTGVRLPATLLFDYPTPGELVAHLYTRVAPAPADGSAVVLAELDKLER
AFAGAEVGAELFDQVAGRLEVLRGKWQEMRAEALKGGEKAEESFDFASASDEDMFDMLDN
ELGLS
selected fasta
>polyketide synthase [FscC]
ATGGCAAGCTCCGAAGCCAAGCTCCGCGACTACCTCAAGAAGGTCACCACCGACCTTCGC
CGCACCCGGCAGCGGCTGGAGACGGTCGAGGCACGGGAGAGCGAGCCCATCGCCGTCATC
GGCATGGCCTGCCGGTTCCCCGGCGGTGTCCGCTCCCCGGAGGACCTGTGGCAGCTGGTC
GCCGACGGCACCGACGCCATCGGCCCCCTCCCCGCGGACCGTGGCTGGGACCTGGACGGC
CTCTACGACCCGGACCCGGGCACCCCCGGCAAGAGCTATGTCCGTGAGGGCGGCTTCCTC
GAAGGCGCGGCCGACTTCGACGCGGACCTGTTCGGCATCGCCCCGCGTGAAGCCCTCGCC
ATGGACCCCCAGCAGCGCCTGCTCCTGGAAACCGCCTGGGAGGCCGTGGAGCGCGCCCGC
ATCAGCCCCGCCTCCCTGCGCAACACCGACACCGGCGTCTTCGTCGGCGGCGCCGACACC
AACTACGGCTCCCTGGCCCGCACCGCCGAGGAGACCGAGGGCCACAACCTCACCGGCGGC
GCCATGAGCGTCCTCTCCGGCCGGATCTCCTACACCCTCGGCCTGGAGGGCCCGGCGGTC
ACCGTCGACACCGCCTGCTCCTCCTCCCTGGTCGCCCTGCACCTCGCGGTCCGCGCCCTG
CGCGCGGGGGAGTGCTCCCTCGCCCTCGCCGGCGGCGTCGCCATGATGCCGACCACCGAA
CTCTTCACCGAGTTCTCCCGCCAGCGCGGCCTCGCCACCGACGGCCGCTGCAAGCCCTTC
GCCGAGGCCGCCGACGGCACTTCCTGGGGCGAAGGCGTCGGCGTGCTGCTCGTCGAGCGG
CTCTCCGACGCCCGCCGCAACGGCCACCCCGTCCTCGCCGTCGTCCGCGGCACCGCCGTC
AACCAGGACGGTGCCAGCAGCCGCCTCACCGCGCCCAACGGGCCCTCCCAGCGCCGCGTC
ATCGAGGCCGCGCTCGCCGACGCCCGCCTCGCCGCCGACCAGGTCGACGCCGTCGAGGCG
CACGGCACCGGCACCACCCTGGGCGACCCCATCGAGGCCCAGGCACTCCTCGCCACCTAC
GGCCAGAACCGCCCGGAGGACCGCCCGCTGCGGCTGGGCGGCATCAAGTCGAACATCGGC
CACGCCCAGGCCGCCGCCGGTGTCGCCGGCGTCATCAAGATGGTCATGGCCATCCGGCAC
GGCCTGCTGCCCGCCACCCTCCACGTCGACACCCCCACCCCGCACGTCGACTGGACGGCC
GGCGCCGTCGAACTCCTCACCGAGGCCGTCGACTGGCCCGACGCCGACCGTCCCCGCCGG
GCCGGCGTCTCCGCCTTCGGCATCAGCGGCACCAACGCCCACGTCCTGCTCGAACAGGCC
ACCCCCGAACCCGCCGGGGCCGAGGACACCCCTCAGGACGCCACCCCCGCCGAACCGGTG
ACGGCCACCGACCCGGCGGTCACCCCCTGGCTCCTCTCCGCCCGTTCGCAGACCGCGCTA
CGCGCCCAGGCGGCACGACTCCTGGCCCACCTCACCGACCACACCGGCCCCGAGTCCCCG
CGCCCGGCGGACATCGCCCTCTCCCTCGCCACCAGCCGCGCCCCGCTCCCGCACCGCGCG
GTCGTCCTCGCCACCGACCCCGGAACCACCGAAGCAGCTCTCACCTCCCTCGCCGCCGAC
GAACCCCACCCCGCTGTCCTGGAGGACGCCGTCCGCAGCGCCTCCACCGCGTTCCTGTTC
TCGGGGCAGGGGTCGCAGCGTCTGGGGATGGGGCGTGGTCTGTACGAGCGTTTCCCGGTG
TTCGCGGAGGCGTTCGACGCGGTGTGCGCCGGGTTGGACGAGCACCTGGAGCGCCCGCTG
CGTGAGGTGGTCTGGGGCGACGACACGTCGGTTCTGGACGGGACGGCGTACGCGCAGGCG
GGTCTCTTCGCCGTCGAGGTGGCGTTGTTCCGGCTGGTTGAGTCGTGGGGTGTGCGGCCG
GAGTTTGTTGCCGGTCATTCGATCGGTGAGGTGGCGGCTGCGCATGTGGCGGGTGTGTTC
TCGCTGGCGGACGCGTGTGTTCTGGTGGCTGCTCGTGGGCGGTTGATGCAGGCGTTGCCG
GAGGGCGGCGCGATGGTGGCTGTGGAGGCGTCGGAGGCGGAGGTGTTGCCGCGTCTGGAG
TCTGTCGAGGGTGTGTCGGTCGCTGCGGTCAACGGTCCGTCGTCGGTGGTCGTTTCGGGC
GCCGAGGACGCGGTCGAGGCGGTGGCGGAGGTGTTCCGTGAGCAGGGACGCCGGGTCAGC
AGGCTGCGGGTGTCGCACGCTTTCCACTCGCCGCTGATGGAGCCGATGCTCGGTGACTTC
CGTGAGGCTCTGGCCGGCCTGTCGTACGCGGAGCCTTCGCTGCCGGTCGTCTCGAACGTC
TCGGGCCGGATCGCGGAGCCGGGTGAACTGACCACGCCGGACTACTGGGTGCGGCATGTC
CGCGAGGCCGTGCGTTTCGACGACGGTGTCCAGGCTCTGGCGGCGGAGGGTGTCGCGCGG
TTCGTGGAGCTGGGGCCCGACGGGGTGCTCAGTGGCATGGCGCGGGTCAGTGCCGGTGAG
GACGCCGTCCTCGTCCCGCTCCTGCGCAAGGACCGTGACGAGGAGGTCACCGCGCTCGCC
GCGCTGGGCCGCCTCCACGCCACCGGTGCGCCCGTCGACTGGACCGCCGTCCTCGCCGGG
ACCGGCGCCCGCCTCGTCGACCTGCCCACGTACGCCTTCCAGCACGAGCACTACTGGCCC
GTGCCCGCACCTGCACCCGCCGGGGACGTGGAGTCCGCCGGACTGCGCGCCGCCGGGCAC
CCCCTGCTCAGCGCCGCCGTCGAACTCTCCGACTCCGGCGGCCTCCTGCTCACCACCCGG
CTGTCGCTGCGCACCCACCCCTGGCTTGGCGAGCACGTCGTCATGGGCAACGCGCTGCTG
CCCGGCACGGCCTTCGTGGAACTCGCGGTCCGCGCCGGCGACGAGGTCGGCTGCGACCGT
GTCGAGGAACTGACCCTCGCCGCCCCGCTGGTCCTGCCCGAGCAGGGCGGCGTCCAGCTC
CACCTGCACGTGGGCCCCGCCGACGCCGCCGGCCGCCGCGTCCTCGCGGCCCGCTCCCGC
GCCGAGGGCGCCGACGACCAGCCCTGGACCGAGCACGCCACCGGTGTCCTCGCTCCCGGG
GAGCGCACCGTGGAGTTCGACACCTCGGTGTGGCCCCCCGCCGACGCCGAATCCCTCGAC
CTCACCGGCCTGTACGAGCGCATGGCCGAGGGCGGCTACCGGTACGGGCCGCTCTTCCAG
GGTCTGCGGGCCGCCTGGCGCCGGGGCGACGACGTCTTCGCCGAGGTCGCCCTGCCCGAC
TCCGCCGAGCGCGACGCCACCGCCTACGGCCTCCACCCGGCGCTCCTCGACGCCTCCCTC
CACGTCTCGGCCCTGGGTGGTCTCGCGCACGGTGTGGTCCCGTTCTCCTGGGAAGGGGTG
TGCCTGCACGCCACCGGCGCCCGGGAGGTCCGGGTCCGGATGACCCGGACCGGCGACGAG
ACCGTGACGGTCGCCGTGGCCGACCCCACCGGTGCGCCCGTCGCCAGCGTCGAGAACCTG
GTGCTCCGCCGGGTCGCCCCCGACGCCACCGGTGTCGACGCCCTGACCCGTGACGCCCTC
TTCCGGGTGGACTGGGTCCGGACCGAGGCACCTGGTGACGCGGCCGGCACCGGTCCGGTC
GGCGTCCTCGGGGATTCCGACGCGTCCACGGCCCTTGCGGGAGTCCTCCGGGCCGACGGG
CTGTCGGACGGCGGGTTCGTGGCCTTCCCCGACCTGGAGGACCTGGCCGCCGCCGAAGAG
GTACCGGCGACGGTGCTGGTCCGGGTGCGTCCCGACGCCGCGACGCGGCCCGACGCGGTG
GTGGACGCCGTCCACGCCCTGGCCGCCCGTGGCCTGGAGCTGGTGCGCGAGTGGCTGGCG
CAGGAGCGGTTCACCGACTCCCGCCTGGTCTTCGTCACCTCGGACGCCGTCGACGGCGGC
GACCTGGCCGACGCGGCCCTCCGGGGCCTGGTGCGCTCCGCCGTCTCCGAGCACCCCGGC
CGCTTCGGCCTGATGGAGGTGGGACGCGGCACCGACACCGCGACCGTGCTGGCCGCCGTC
GCCACGGGCGAGCCGGAGACCGCCGCACGCGACGGCGAGGTGCTCGCCCCGCGACTGGCC
CGGATCACCTCCGGCACCACGACGGGCCCGCGCTGGGACAGCATCGACGGCACTGTGCTG
CTGACCGGCGGTACGGGTGGGCTGGGGCGGATCGTCGCCCGGCACCTGGTGGTCGAGCGC
GGGGTGCGGGACCTGCTGCTGGTGAGCCGCAGCGGCGCCGCCGCCGACGGCGCCGGGCAA
CTGGTCGCCGAACTGTCCGAGACCGGTGCGCACGTGACCGTCGAGGCGTGCGACGTCTCC
GACCCCGCCGCCGTCGCGGAGCTGGTCGCCCGCCACCCGGTGCGCGCGGTCGTCCACTCC
GCCGGGGTGCTGGACGACGGCACGGTGGAATCACTCACGGCCGAGCGCGTGACCCGCGTC
CTGCGCCCGAAGGCGGACGCCGCGTGGAACCTGCACGAGGCCACCCGCGCCCTCGACCTC
GAAGCCTTCGTCGTCTTCTCCTCGATGTCCGGCATCCTCGGCGGCCCCGGCCAGGCCAAC
TACGCGGCCGGCAACACCTTCCTCGACGCCCTGGTACGCCACCGCCGCAGCCTCGGCCTG
CCCGCGACCTCGCTCGCCTGGGGCCCGTGGACCCAGGACGCCGGCATGATCGGCACCCTC
TCCGGGACCAGCCGGCACCGCGTCGCCCGCGCAGGCATGCCCGAGCTGACCGCCGAGCAG
GGGACCGCGCTCTTCGACGCGGCCCTGGCCTCCGGTGAGCCGGTCGTCCTCCCTGTCCGC
CTCGACCTGGCCGCCCTGCGGGGGCAGGGTGACCTGCACCCGATGATGCTCGGTCTGGTG
CGGCGGCGTGGTCGTCGTGCGGCTGCGGGTGGTTCGGTGGCGGCGGCTGGTCTGGTGCAG
CGTCTTGGGGCGTTGGGCGTAGATGAGCGTCGTGAGGTGTTGCTGGATCTGGTGCGTGGT
CAGGTCGCTGTGGTGTTGGGTCATGCGGGTGTGCAGTCGGTGGATCCGGGGCGTGCGTTT
CAGGATCTGGGTTTCGATTCGTTGACCGCGGTGGAGTTGCGGAACCGGTTGGGGAAGTCG
ACGGGGTTGCGGTTGCCGGCGACGGTGGTGTTCGACTATCCGACGGTCAACGCGTTGGTG
GGGTATCTGCTGGAGGAGCTGTTCGGCGGGGTGGAGCCTGCGTCGGTCGTGCCGGTGTCG
GCGCTGCCGTCGGTGGCCGAGGACCCGATCGTGATCGTGGGCATGGCCTGCCGCTACCCG
GGCGGTGTCTCCTCGCCGGAGGATCTCTGGACCGTCGTCTCCGAAGGCGTCGACACCGTC
TCCGAGTTCCCCGTCAACCGAGGCTGGGACGTCGACGCGCTCTACAACCCCGACCGGGAC
GCGTCCGGTACCACCTACACCAAGGCCGGTGGCTTCCTGCACGACGCCGGAGCCTTCGAC
TCCGAGTTCTTCGGGATGAGCCCGCGCGAGGCGGTGGCGACCGACTCCCAGCAGCGTCTT
CTCCTGGAGACGACGTGGGAGGCGATCGAGCGGTCCGGTATCGACCCGGCCTCCCTGCGC
GGCAGCCAGACGGGCGTCTTCGCCGGTGTCATGTACAACGACTACGGCAACATGCTCGCC
GACGAGCGGTATGAGGGCTTCCGCAGCAACGGCAGCGCACCCAGCATCGCGTCCGGCCGT
GTCTCGTACACGTTCGGGTTCGAGGGTCCGGCGGTGACGGTGGACACGGCGTGCTCGTCG
TCGTTGGTGGCGTTGCACTGGGCTGCGCAGGCGTTGCGTTCGGGTGAGTGCTCGTTGGCG
GTGGCCGGTGGCGTGACGGTGATGTCGACGCCGACGACGTTCGTGGAGTTCTCGCGTCAG
GGTGGTCTGTCGGCGGACGGGCGGTGCCGTTCGTTCGCGGACTCGGCTGACGGTGTGGGC
TGGTCCGAGGGTGTGGGCATGGTGGTGCTGGAGCGTCTCTCCGACGCCCGGCGCAACGGT
CATCGTGTGCTGGCGGTGGTGCGTGGTTCGGCGGTGAACCAGGACGGTGCGTCGAACGGT
CTGACGGCGCCCAACGGTCCCTCCCAGCAGCGTGTCATCCGTCAGGCTCTGGCCAGTGGT
GGTCTGTCGGCCGGTGATGTGGACGTCGTGGAGGCGCACGGCACGGGGACGACGCTGGGT
GACCCGATCGAGGCGCAGGCACTCCTGGCCACGTACGGGCAGGAGCGTGAGGAGGGCCGG
CCGCTCTGGCTCGGTTCGGTGAAGTCGAACCTCGGCCACACGCAGGCTGCGGCGGGTGTC
GCGGGTGTCATCAAGATGGTGATGGCGATGCGTCACGGTAGGCTGCCGCGCACGCTGCAT
GTGGATGCTCCGTCGTCGCACGTCGACTGGTCGGCAGGCGCTGTGGAGTTGCTGACCGGT
GAGCGGGTGTGGCCGGGGGAGGAGCGGCTGCGCCGGGCCGGTGTGTCCTCGTTCGGCATC
AGCGGCACCAACGCCCACGTCATCCTCGAACAGCCCGAGCCGGTCGCGGAACCCGAGACC
GGCGGGGACGGGATCGCCGCCCTCGCCCCCGGCATCGTGCCGTGGGTCCTGTCGGGCCGT
ACCGAGGAGGCGCTGCGCGCCCAGGCCGCCCGGCTGCTGGCCCAGGTCGAGGGCCACCCC
GGCCTGCGTCCCGTGGACCTGGCGCTCTCCCTGGCCACGCAGCGTTCCCTCTTCGACCAC
CGCGCCGTGGTCCTGACGGACGACCGCGAGACCGCCGTCCGTGGCCTCGCGGCCGTCTGC
GTCGGTGAGCCCGACCCCGCCGTCGTCCTCGGCGCCGTCGAGCCCGGCCGCACCGCGTTC
CTGTTCTCGGGGCAGGGGTCGCAGCGTCTGGGGATGGGGCGTGGTCTGTACGAGCGTTTC
CCGGTGTTCGCGGAGGCGTTCGACGCGGTCTGCGCCGGACTCGACGCGCACCTGGACCGC
CCGCTGCGTGAGGTGGTCTGGGGCGACGACACGTCGGTTCTGGACGGGACGGCGTACGCG
CAGGCCGGTCTCTTCGCCGTCGAGGTGGCGTTGTTCCGGCTGGTCGAGTCGTGGGGTGTG
CGGCCGGAGTTCGTTGCCGGTCATTCGATCGGTGAGGTGGCGGCTGCGCATGTGGCGGGT
GTGTTCTCGCTGGCGGACGCGTGTGTTCTGGTGGCTGCTCGTGGGCGGTTGATGCAGGCG
TTGCCGGAGGGCGGCGCGATGGTGGCTGTGGAGGCGTCGGAGGCGGAGGTGCTGCCGCGT
CTGGAGTCCGTCGAGGGTGTGTCGGTCGCTGCGGTCAACGGTCCGTCGTCCGTGGTCGTC
TCGGGCGCCGAGGAAGCCGTCGAGGCGGTGGCGGAGGTGTTCCGTGAGCTGGGGCGTCGG
GTCAGCCGACTGCGCGTGTCGCACGCTTTCCACTCGCCGCTCATGGAGCCCATGCTCGAC
GCGTTCCACGAGGTCCTGCGGGATCTGTCGTTCGCCGAGCCGCGCCTGCCGGTCGTCTCG
AACGTCTCGGGCCGGATTGCCGAGCCGGGTGAACTGACCGCGCCGGACTACTGGGTGCGG
CATGTCCGTGAGGCCGTCCGGTTCGACGACGGTGTGCGGGCCCTCGCGGAAGAGGGCGTC
ACTCGGTTCGTGGAGCTGGGTCCCGACGGGGTGCTCAGTGGCATGGCGCGGGCCAGTGCC
GGTGAGGACGCCGTCCTCGTCCCGCTCCTGCGCAAGGACCGCGAGGAAGTGGCCGTCGCA
CTGAGCGCCCTCGCCGAACTGCACGTGCGGGGCGTCTCCGCCGGCTGGGGCGCCGTCCTC
GACGGCACGGGCGGCCGCGCGGTCGACCTGCCCACCTACGCGTTCCAGCACGAGCACTAC
TGGCCCACGGGAACGACCACCGGGACCGGGGACATCCGCCTCGCCGGACTCGGTGCGGCC
GGGCACCCGTTGCTCGGCGCGGCCGTGGAGCTGGCCGGCGCCGACGGTCTGATCCTCACC
GGACGCCTCTCGACACGGTCGCACCCGTGGCTCGCCGACCACGTCGTCCAGGGTGCCGTG
CTGGTGCCGGGGACGGCCCTGCTGGAGATGGCCGTGCGCGCCGCCGACGAGGCGGGCTGC
GGATCGGTCGAGGAGCTGACCCTGTCCGCGCCCCTGGTGCTGCCCGAGCGCGGCGCCGTG
CGCGTCCAGGTGGGCGTCGGCGAACCTGACGAATCCGGCCGCCGCACCGTCGCGATCCAC
TCCCGGGACGACGGCGACGAACGGCAGCCCTGGAGCCTGCACGCCCAGGGCGTACTCGCC
CCGGAGACCATCGACGCGGACCCGGCGGCCGAAGGCTTCGACGCCTCCGTATGGCCCCCA
CGGGACGCCGTGCCGGTCGACGTGACCGACTGCTACGAGAGCCTGGCCGAGGCCGGACTG
CGCTACGGCCCCGTCTTCCAGGGGCTGCGGGCCGCCTGGCGCCGGGACGACGAGGTGTTC
GCCGAGGTCGCCCTGCCCGACGGTGTCGACGCCACCGCCTTCGGCCTGCACCCGGCCCTC
TTCGACGCCGCCCTGCACGCCTCCTTCGCCTTCGGCGGCGACGACGCGCCCGGCGGGGTG
CCCTTCGTCTGGGAGAACGCCACCCTGCACGCGTCCGGCGCCTCCGTCCTGCGGACCCGG
CTGACCCGGACCGGTGACGACACGCTGGCCGTGCACGTGGCCGACCCGACCGGAGCCCCC
GTCGCCTCGGTCGGCTCCCTCACCGTCCGCGCCGCCGCCGGTGCCCGCGCGGCCGACACC
GCCGAACCGCTGTACCGCGTGGAGTGGGTCCCGGCCCGGGGCACGCGTGCGACTCCCGCA
GCGGGATCCGTCGTCCTCCTCGGCGAGGGCCTCGCCGATCTCGCGGGCGACGGCGCAGCC
GTCCGCGCCGACCTGCAGGAGCTGGCCGCGGCCGAGGCGGTGCCGGAGACGGTCGTGGTC
GCCGTTCCGCCCGCCCCGGACACCGAGGGCGTCGTGGGCTCCGCGCACGCCTCGGCCGCC
TGGGCGCTCGCCCTGGTCAAGGAGTGGCTGGCGCAGGAGCGGTTCGCCGGCTCCCGGCTG
GTCTTCATCACCCGAGGCGGTCACGTCACGGAGCCCGCCTCCGCTCTGACTAGCGCGCCC
GTACGCGGTCTGGTGCGTTCCGTGGCGCTGGAACACCCCGGCCGCTTCGGCCTGCTGCAC
CTCCCGGCGGGTACGGACGCGGGGCGGCTGTTCGCGGCCCTCGCCGTGGACGAGCCGGAG
ACGGCCGTGCTGGACAGCGAGGTGTGCGTCCCGCGCCTGGTCCGCACGACGCCGGACGCC
GGGGGAGAGGAGACCGCGGGATCGTCGGCCGGTCTCGGCTCCGGCACCGTGCTGCTGACC
GGCGGCACAGGTGGGCTGGGGCGGATCGTCGCCCGGCACCTGGTGGTCGAGCGCGGGGTG
CGGGACCTGCTGCTCGTGAGCCGGAGCGGTGCCGCCGCCGAGGGCGTCGACGCCTTCACC
GCGGAGCTGACCGGCCTCGGCGCCCGGGTGTCGGTCGCCGCCTGCGACCTGGCCGACCGC
ACCGCGCTCGACGCCCTGCTGGCCGGAGTACCGGCCGACCGCCCGGTGCGCGCCGTCGTG
CACGCGGCGGGCGTCCTGGACGACGGCATGGCCGAGTCGCTGACGGCGGAGCGGGTTGCT
GCGGTCCTGCGTCCGAAGGTGGACGCGGCGTGGAACCTGCACGAGGCGACGCGTGGCCTT
GATCTTGAGGCGTTCGTGGTGTTCTCGTCGGTGGCGGGGACGTTCGGGAGTGCGGGGCAG
GGCGCGTACGCGGCGGGGAACGTGTTCCTGGACGCGTTGGTGGAGTACCGGCGTTCTCTG
GGTCTTCCCGGTGTGTCGCTGGTGTGGGGTCCGTGGGCGCAGGACGCGGGGATGACACGA
GGACTGTCGGAGACTGACCGGCGGCGTATCGCCCGGTCCGGTCTGCCGCCGGTCGAGGCC
GAGCAGGGGACCGCGCTCTTCGACGCGGCCCTGGCCTCGGGTGAGCCGGTCGTCCTCCCC
GTCCGCCTCGACCTGGCCGCCCTGCGCGGTGAGGAGGACGTACCGGCTCTCTTCCGGGGT
CTGGTGCGGCGGCGTGGTCGTCGTGCGGCTGCGGGTGGTTCGGTGGCGGCGGCTGGTCTG
GTGCAGCGTCTTGGGGCGTTGGGCGTAGATGAGCGTCGTGAGGTGTTGCTGGATCTGGTG
CGTGGTCAGGTCGCTGTGGTGTTGGGTCATGCGGGTGTGCAGTCGGTGGATCCGGGGCGT
GCGTTTCAGGATCTGGGTTTTGATTCGTTGACTGCGGTGGAGTTGCGGAACCGGTTGGGG
AAGTCGACGGGGTTGCGGTTGCCGGCGACGGTGGTGTTCGACTATCCGACGGTCAACGCG
TTGGTGGGGTACCTGCTGGAGGAACTGTTCGGTGGGGTGGAGCCGGCGGCGGTGGTGCCG
GTGTCGGCGCTGCCGTCGGTGGCCGAGGACCCGATCGTGATCGTGGGCATGGCCTGCCGC
TACCCCGGTGGCGTCTCCTCGCCGGAGGACCTGTGGCGCGTCGTCTCCGAGGGCGTCGAC
ACGGTCTCGGACTTCCCCTCGGACCGAGGCTGGGACGTGGACGCGCTCTACAACCCCGAC
CGCGCTGTGCCGGGCACCTCCTACACGCGTTCTGGTGGCTTCCTGCACGACGCGCCCGAG
TTCGACCCGGAGTTCTTCGGGATGAGCCCGCGTGAGGCCGTCTCCACGGACGCGCAGCAG
CGTCTTCTGCTGGAGACGACGTGGGAGGCGATCGAGCGGTCCGGTATCGACCCGGTCTCC
CTGCGCGGCAGCCAGACCGGTGTCTTCGCCGGCGTCATGTACCACGACTACGCCAACCTG
CTGGCCTCCCCGGAGTACGAGGGGTACCAGGGCAGCGGTAGTGCCGGAAGTGTGGCCTCG
GGCCGTGTTTCGTACACGTTCGGGTTCGAGGGTCCGGCGGTGACGGTGGACACGGCGTGC
TCGTCGTCGTTGGTGGCGTTGCACTGGGCTGCGCAGGCGTTGCGTTCGGGTGAGTGCTCG
TTGGCGGTGGCCGGTGGTGTGACGGTGATGTCGACGCCATCGACGTTCGTGGAGTTCTCG
CGTCAGGGTGGTCTGTCGGCGGACGGGCGGTGCCGTTCGTTCGCGGACTCGGCTGACGGT
GTGGGCTGGTCCGAGGGCGTGGGCATGGTGGTGCTGGAGCGTCTGTCGGATGCCCGGCGC
AACGGTCATCGTGTGCTGGCGGTGGTGCGTGGTTCGGCGGTGAACCAGGACGGTGCGTCG
AACGGTCTGACGGCGCCCAACGGTCCTTCCCAGCAGCGGGTCATCCGTCAGGCTCTGGCG
AGTGGTGGTCTGTCGGCCGGTGATGTGGATGTCGTGGAGGCGCACGGTACGGGGACGACG
TTGGGTGACCCGATCGAGGCGCAGGCGCTCCTGGCGACGTACGGGCAGGGCCGGGACGAG
GAGCGGCCGTTGCTGCTCGGTTCCGTCAAGTCCAACATCGGGCACACGCAGGCTGCCGCC
GGTGTGGCGGGTGTGATCAAGATGGTGATGGCGATGCGTCACGGCAGGCTGCCGCGCACG
CTGCATGTGGATGCTCCGTCGTCGCACGTCGACTGGTCGGCCGGTGCTGTGGAGTTGCTG
ACCGGTGAGCGGGTGTGGCCGGGGGAGGAGCGGGCTCGCCGGGCCGGTGTGTCCTCGTTC
GGGATCAGCGGCACCAACGCCCACGTCATCCTCGAACAGCCCGAGCCGGTCACCGGGTCG
GGCCCGGGAGAGGCAGACGGGACGGAGGCATCGTCCGGTGTCCAGCCGTGGGTCCTGTCG
GCTCGTACCGAGGAGGCACTGCGCGCCCAGGCCGCCCGCCTGGCCGACTTCCTCACCGAC
GCGCCGGCGGACGTACGGGACGTGGCGCTCTCTCTGGCCACGCAGCGCACCCTCTTCGAC
CACCGCGCGGTGGTCCTGGGCGCCGACCTGGAAACGGCGCTGACGTCCCTTCGCGCGCTG
GCCGCCGGGGCTCCCGACGCCGCCGTCGCGGAAGGCGTGGCCGGGAACGGTCGCACCGCC
TTCCTCTTCCCCGGGCAGGGCTCCCAGCGGCTCGGTATGGGGCGTGACCTGTACGAACGG
TTCCCCGTCCTCGCCGAGGCGTTCGACGCGGTCTGCGCCGAGCTGGACGAGCACCTGGAC
CGCCCGCTCCGCGAGGTCGTGTGGGGCGACGACGCCGAACTCCTGAACCGCACGGCGTAC
GCCCAGCCGGGTCTGTTCGCCGTCGAGGTGGCGTTGTTCCGGCTGGTCGAGTCGTGGGGG
GTGCGGCCGGAGTTCGTGGCCGGTCACTCCATCGGTGAGGTCGCCGCTGCGCACGTGGCC
GGGGTGTTCACCCTCGCCGACGCCGCCGCGCTCGTCGCCGCCCGTGGCCGTCTGATGCAG
GCGCTGCCCGAGGGCGGCGCCATGGCGGCGGTCGAGGCCACGTGCGCCGAGGTACTGCCG
CACCTCACCGGCAACCTGTCCATCGCCGCCGTCAACGGCCCGTCCTCGGTGGTCGTCTCG
GGCTCCGAGGCCTCCGTCGAGTCGGTCGCCGAGGTCTTCCGGGAGCTGGGCCGCCGGGTC
AGCCGGCTGCGCGTCTCGCACGCCTTCCACTCCCCGCTGATGGAGCCGATGCTCCACGCG
TTCCGCGAGGTGGTGGAGGGGCTGTCCTTCGCGGCGCCGAGGATCCCGCTGGTCTCGAAC
ATCACCGGCACGCTCGCCGAACCGGGACAGGTGGACGAGCCCGAGTACTGGGTCACCCAC
GTCCGCGAGGCCGTCCGGTTCGACGACGGTGTCCGGGCCCTCGCGGAAGAGGGCGTCACC
CGGTTCGTGGAGGTGGGCCCCGACGGCGTGCTCAGCGGCATGGCGCGCGAGAGCGCCGGT
GAGGACGCCGTCCTCGTCCCGCTCCTGCGCAAGGACCGCGAGGAGACGGGCTCGGCGCTC
AGCGCCCTCGGCCGGCTCCACACCGTCGGCGTGGACGTCGACTGGTCCGGCTTCCTCGTG
GGCGCCCGCCCCGTCGACCTGCCGACCTACGCCTTCCAGAAGCAGCGCTACTGGCCCGAG
GCCACGCTCCCGCGCGCCGGTGACGTGCGCTTCGCGGGTCTCGGCTCCGCCGGTCACCCG
CTGCTCGGCGCGGCCGTCGAACTCGCCGGCGCCGACGGCGCGGACGGGGTGGTCCTCACC
GGACGCCTGTCGACGCGGTCGCACCCGTGGCTCGCGGACCACGTCGTCCAGGGCACCGTG
CTGGTGCCGGGCACGGCCCTGCTGGAGATGGCCGTCCGTGCCGCCGACGAGGCGGGCTGC
GGATCGGTCGAGGAACTGACGCTCTCCGCCCCGCTGGTCCTGCCCGAACGCGGCGCCCTC
CAGATCCAGATACGGGTCGCCGCTCCCGACGAGGACGGCCGCCGTGCCCTCGGCGTACAC
GCGCGCACCGAGGACGACGACGGTGCTCCGTGGACCGTCCACGCCACCGGAACCCTCGCC
CCCGAGACCCTCGCCCCCGACCCCTTCGACGCCACCGTCTGGCCGCCGCGCGACGCGGCC
CAGGTCGACGTGACCGACTGCTACGAGCGCCTGGCCGAGGCCGGCTTCGCCTACGGCCCC
GCCTTCCGGGGGCTGCGGGCCGCCTGGCGGCACGGCGACGCCCTGTACGCCGAGGTCGCC
CTGGACGGGGGGACCGACGGCGACGCCTTCGGCCTGCATCCCGCGCTCTTCGACGCCGCG
CTGCACGCCTTCGCCCTCGCCGACGACGGCCGTGGAGGTGTCCCGTTCTCCTGGGGCGGC
GTTTCCCTCCATGCCTCCGGCGCCACGGCCCTCCGCGTCCGTCTCACCCGGGACGCCGAC
GGCACCATGGCCCTCGCCCTCGCCGACCCCGCTGGTTCCCCGGTCGCCACTGTCCACTCC
CTGACGGTGCGCCCGCTCGCCACGGGACAGCTCACCACCCCGGCGCGGGACTCCCTCTAC
CAGGTGGAGTGGGTCCCGGCCCGGCCGCTGGACGGTCCTGCCGACACCGGTGCGGTGGCC
GTCCTCGGCGAGGCCCGGAGCGCCGTGCCGGCCGCCGACGACTTCGTCACGTACGCCACC
TTGGAGGAGCTGGCGGCCGCCGAGGAGATGCCCTCCACGGTGCTGGTGGCCGCCTCCGAC
GACGCCGACGGGACCGATCCGGCCCAGGCCGCGCACACCGCCGCCGCCCGGGCTCTCGCC
CTGGTGCGGTCGTGGCTGGCCGAGGACCGGTTCGCCGGATCCCGCCTGGTCTTCGTCACG
GCCTCCACCGACCGCACCACCGGACTCGCCGACGCCGCCGCCCGGGGGCTGGTGCGCTCC
GCGATCTCCGAACACCCGGGCCGATTCGGCCTGTTGGAGCTTCCGGCCGACGCGGACACC
GCGTCCCTCCGCTCCGCGCTCGCCTCCGGCGAGGCGGAGTCGGTGGTGCGGGACGGCGAG
GTGCGGGTGCCGCGCCTGGCCCGCGTCACACCGGAAGCAACCGAGGGCCTGCGCTGGGAC
GCCCTCACCGGTCCGGTGCTGATCACCGGCGGTACCGGCGGCCTGGGCCGGGTACTGGCC
CGCCACCTCGTCATGACGCACGGAGTGCGGGACCTGCTGCTGGTCAGCCGGAGCGGTGCC
AACGCCGAGGGCGCCGGGGAACTCGTCACCGAACTGACGGAGGCCGGCGCACACGTGGCC
GTCGAGGCATGCGACGCCGCCGACGCCGATGCCGTCGCCGGGCTCGTCACCCGGCACGGC
GTGCGCGCGGTGGTACACGCGGCTGGCGTCATCGACGACGCCACGCTCGCATCGCTGACG
GCGGAGCGCGTCGCGGCGGTGTTGCGTCCGAAGGTGGACGCGGCGTGGAACCTGCACGAG
GCGACGCGGGACCTGGGCCTTGAGGCGTTCGTGGTGTTCTCGTCGGTGGCGGGGACGTTC
GGGAGTGCGGGGCAGGGCGCGTACGCGGCGGGGAACGTGTTCCTGGACGCGTTGGTGGAG
TACCGGCGGGCCCTGGGGCTCCCTGGTGTCTCTCTTGTCTGGGGTCCGTGGGCGCAGGAC
GCGGGGATGACGCGGGAGTTGTCGGAGACCGACCGGCGGCGTATCGCCCGGTCCGGTCTG
CCGCCGGTCGAGGCCGAGCAGGGGACCGCCCTGTTCGACGCGGCCCTGGCTTCGGGTGAG
CCGGTCGTGCTTCCCGTCCGCCTCGACCTCCCGGCGCTGCGCGCCCAGGGTGAGGTGCCG
CCGCTGCTCAGCGGGCTGATCCGCACCTCCGTCCGCCGCACCGCCGCCGCAGCCGGTGCC
GCCGCCACCGGCCTGGCCGCGCGCCTCGCCGGCCTCGCGGAGGCCGAGCGCCGCGAGGTG
CTGCTCGACCTGGTCCGTGGCCAGATCGCCGTCGTCCTCGGCCATTCCGGTGCCCAGACC
GTCAACCCGCACCGCGCCTTCCAGGACCTCGGTTTCGATTCCCTGACGGCTGTGGAACTG
CGCAACCGGCTCGGCAAGGTCACCGGCCTGCGCCTGCCCGCGACGGTCGTCTTCGACTAC
CCGACCGCCGACCTCCTCGCCGGTCACCTCCTCGACGGCGTCCTCGGCACCGAGCCGGCC
GTGGCGGTCCCCGTCGCGGCGCTGCCCTCCGTGGCCGACGACCCGGTCGTCATCGTCGGC
ATGGCCTGCCGCTACCCGGGCGGCGTCACGTCCCCCGAGGACCTGTGGAGCGTCGTCTCC
GACGGCGTCGACGCGGTCGGGGACTTCCCCTCCGACCGTGGCTGGGACGTGGAATCCCTC
TACAGCGAGGACCGGGGCGTGCCCGGCACCACGTACACCCGGTCCGGTGGCTTCCTGCAC
GACGCGCCCGAGTTCGACCCGGAGTTCTTCGGGATGAGCCCGCGTGAGGCCGTCTCCACG
GACGCGCAGCAGCGTCTCCTGCTGGAGACGACGTGGGAAGCGATCGAGCGGTCCGGTATC
GACCCGGTCTCCCTGCGCGGCAGCCAGACCGGTGTCTTCGCCGGTGTCATGTACAACGAC
TACGGCAGCATCCTCACCGACGACCAGTACGAGGGCTATCGCGGCAACGGCAGCGCGGGC
AGCATCGCCTCGGGCCGTGTCTCCTACACCTTCGGCTTCGAAGGACCCGCGGTCACGGTC
GACACCGCCTGCTCCTCGTCGCTCGTCGCCATGCACTGGGCGGCGCAGGCGCTGCGCTCC
GGTGAGTGCTCGCTGGCCGTGGCCGGCGGCGTCACCGTCATGGCCACCCCCACCGCCTTC
GTGGAGTTCTCCCGCCAGGGCGCCCTCTCCCCGGACAGCCGCTGCAAGGCGTTCTCCGAC
GCCGCCGACGGCGCGGGCTGGTCCGAGGGCGTGGGCATGGTGGTGCTGGAGCGTCTGTCG
GATGCCCGGCGCAACGGTCATCGTGTGCTGGCGGTGGTGCGTGGTTCGGCGGTGAACCAG
GACGGTGCGTCGAACGGTCTGACGGCGCCCAACGGTCCTTCCCAGCAGCGGGTCATCCGT
CAGGCTCTGGCGAGCGGTGGTCTGTCCGCCGGTGATGTGGATGTCGTGGAGGCGCACGGT
ACGGGGACGACGTTGGGTGACCCGATCGAGGCACAGGCGCTCCTGGCGACGTACGGGCAG
GGCCGGGACGAGGAGCGGCCGTTGCTGCTCGGTTCCGTCAAGTCCAACATCGGGCACACG
CAGGCTGCCGCCGGTGTGGCGGGTGTGATCAAGATGGTGATGGCGATGCGTCACGGCAGG
CTACCGCGCACGCTGCATGTGGATGCTCCGTCGTCGCACGTCGACTGGTCGGCCGGTGCT
GTGGAGTTGCTGACCGGTGAGCGGGTGTGGCCGGGGGAGGAGCGGCTGCGCCGGGCCGGT
GTGTCCTCGTTCGGGATCAGCGGCACCAACGCCCACGTCATCCTCGAACAGCCGGAGGAG
GCGCAGGAGCCCGCGCCCACGGTGGCGCCCGCCGTCGACGTGCCGTGGGTGCTCTCCGCA
CGGTCGGCCCCGGCGCTGCGCGCCCAGGCCGAGCGGCTGCGCGTGCACGTGGCCGCCGAA
CCGGTGAGCGCGCCGGACGTGGCCTTCTCGCTGGTCTCCGGCCGCGCCACCTTCGACCAC
CGGGCGGTGGTCCTGGGCACCGACCGTGAAGCGGCCCTGGAAGCCCTGGCCTCGGGTCTG
CCCGACGCGGGCGTCGTGGAAGGCGTGGCCACCGGAGGCCGTACCGCGTTCCTGTTCTCG
GGACAGGGGTCGCAGCGTCTGGGAATGGGGCGTGGGCTGTACGAGCGTTTCCCGGTGTTC
GCGGAGGCGTTCGACGCGGTCTGCGCCGGGTTGGACGAGCACCTGGAGCGCCCGCTGCGT
GAGGTGGTCTGGGGCGACGACACGTCGGTTCTGGACGGGACGGCGTACGCGCAGGCCGGT
CTCTTCGCCGTCGAGGTGGCGTTGTTCCGGCTGGTCGAGTCGTGGGGGGTGCGGCCGGAG
TTCGTGGCCGGTCACTCCATCGGTGAGGTCGCCGCTGCGCACGTGGCCGGGGTGTTCACC
CTCGCCGACGCCGCCGCGCTCGTCGCCGCCCGTGGCCGTCTGATGCAGGCGCTGCCCGAG
GGGGGCGCCATGGTCGCCCTGGAGGCGTCGGAGGCGGAGGTGCTGCCGCGACTGGAATCC
GTCGAGGGGGTGTCCGTCGCCGCCGTCAACGGGTCTTCCTCCGTGGTCGTCTCGGGCGCC
GAGGACGCCGTCGAGGCGGTCGCCGAGGTCTTCCGTGAGCAGGGACGCCGGGTCAGCAGG
CTGCGGGTGTCGCACGCTTTCCACTCGCCGCTGATGGAGCCGATGCTCGGTGACTTCCGA
GAGGTTCTGTCCGGCCTGTCGTACGCGGAGCCTTCGCTGCCGGTCGTCTCGAACGTCTCG
GGCCGGATCGCGGAACCCGGTGAACTGACCACGCCTGACTACTGGGTCACCCACGTCCGC
GAGGCCGTCCGCTTCGACGACGGTGTCCGGGCCCTCGCGGAGGAGGGCGTCACCCGGTTC
GTGGAGCTGGGTCCGGACGGGGTGCTCAGCGGCATGGCGCGCGAGGGCGCCGGTGAGGAC
GCCGTCCTCGTCCCGCTCCTGCGCAAGGACCGTGAGGAGACGTCGACGGCGCTCGCCGCG
CTGGCCCGTCTCCACACGGTGGGCGCCGAGGTGAAGTGGACCGGCTTCTTCGCCGGTACC
GCGGCCCGCACCGTGGACCTGCCGACCTACGCCTTCCAGAAGCGGCGCTTCTGGCCGGAG
ACCACGGTCCGCGCCGCCGCCGACCCCAGGTCGGCGGGGGTCGACGCGGCCGACCACCCG
TTGCTAGGCGCGGTGGTGTCACTGCCGGACTCGGGTGGCGTGGTGCTGACGGGCCGGCTG
TCGGTGGAGGCGCAGCCGTGGCTCGCCGACCACGTGGTCCTCGGCCGGGTCCTGCTGCCC
GGTACGGGCCTGGTGGAACTGGCCCTCGCGGCCGGGGACGCGGCCGGCTCCACCGCTCTC
GAGGAGCTGACCCTCGCCGCGCCGCTGGTGCTGCCCGAGGACACCGGCCTCCAGCTCCGC
GTCGTCGCGGGGCCGAAGACCGACGGACGCCGCACCGTGGCCGTCCACTCCCGTCCCGAG
GGCGCGGAGGACGCGCCGTGGACGGCCCACGCGCACGGCTTCCTCACCGACGCCCCGGCA
GGCTCCGGCGAAGCGCTGACCGAGTGGCCCCCGCCCGGCGCCGACCCGGTACCGGTCGAG
CACGCCTACGAGGAGTTCCGCCACCGGGGATACGGCTACGGGCCGGTCTTCCAGGGCCTG
CGCGCCGCCTGGCGGCGCGACGACGCGATGTTCGCGGAAGTGGCGCTCCCCGAGGACGCG
GCAGGTGAGGCGGGCCGGTTCGGCCTGCACCCGGCCGTACTCGACGCCGCCATGCACGCC
GGCATCCTGAACGAGGAGGAGGGCCAGGCGGTCGTCCCGTTCGCCTGGAACGACGTGACT
CTCCACGCCGTCGGCGCCTCCGCCGTCCGCGTACGCGTGAGCCGCGTCGACGCCCACACC
GTCTCCCTGACCCTCGCCGACTCCACCGGCGCGCCGGTCCTGACCGTGGGCTCCCTGGCG
AGCCGCCCGGTCTCCGCCGAACAGCTCGGCAGCGCCTCCGCCGGCGCGGGCGCCCTCTAC
GGCATCGAGTGGACGCCGGTCACCGTGGACACCTCCACGGCCCCCGCCCACGTCTCCTGG
GCCGAAGCCCTGGAGGCGGACACCACGGCGCCGGGCGCGGTCGTCCTGGAGGTGCGCGAG
CCCGCCGGTCCGGACGTCCCTGCCGCCGTCCGGGCCGTCCTGGACCAGGTCCTTCCCGCG
ATCCAGCAGTGGCTCCGCGACGAGCGCTTCACCTCCTCGCGTCTGGTCGTCGTCACCCGT
GGCGCCGCCCCGGCCGGTTCATCCGCCGACGTCGTCCAGGCCCCCGTGTGGGGTCTGGTG
CGGGCGGCACTCGCGGAGAACCCGGGCCGGTTCGCCCTGGCCGATGTCTCCGTGGACGCG
GATGACGCGGCGGTGGACCGTGCGGTCGCGGCTGCCCTCTCGGGCGAGGCCGAGGTCGCC
GTCCGTGACGGTGTTGTGCTGGTGCCGAGGCTCAGTCGTCTCGCCGAGCCTGAACTGCCC
CTGTCCGTGCCGTCGCTGGATGGTGAGGGTGCGGTGCTGGTGACGGGTGGTACGGGTGGT
CTGGGTGCGGTGATGGCGCGGTATCTGGTGGCTGAGCGTGGTGTGCGGGATCTGGTGCTG
GTGTCGCGGCGGGGCGGGGACGCCCCGGGCGCGGCGGAGCTGGCCGGGGAACTGCGTGAG
GCCGGCGCGGCGGTGGAGGTCGTCGCGTGCGACCTGTCCGACCGCGAATCGGTCGTCGGC
CTGGTCGAGTCCCTCGTCGCCGGGCGTGGGCTGCGCGCCGTCGTGCACGCGGCCGGGGTC
GGCGGCGGCGGCCTGGTGGGCACGCTGTCGTCCGACCGGTTCGATGCGGTGCTGGGTGCG
AAGGCTGATGCGGCGTGGTGGTTGCACGAGGCGACGGCGGGTGTGGAGCTGGCTGCGTTC
GTGCTGGTGTCGTCGGCGGGTGGTCTGGTGCTGACGGCGGGCCAGGGGAATTACGCGGCG
GCCAATGTGTTCCTGGACGCGTTGGCGTCGCGGCGTCGGGCCGAGGGTCTGGTGGCCACG
TCCATGGCGTTCGGGTTCTGGGACGTGGGTGCGGGGCTGGGGGAGTATCTGTCGGAGGTG
GACCGGCGTCGGATGGCGTCGCAGGGGCTGCCGTTGCTGTCGCACGAGGCGGGGCTGGAG
CTGTTCGCGGCCGGCCTGGACCGGGGCGAGGCGACGGTCGTGCCGCTGCGCGTCGACACC
GCCGCGCTGCGCACCCGCACCGACGAGATCCCCGCCCTGCTCAAGTCCCTCGCTCCCGTG
CGGCGCTCCGCGGCCGTGGTCCCCCCGGCCACCGTCGAGGGCTCGCCGGCCCACCGGCTG
GCCTCGCTTCCGGAGGCGGAGCGGCACCGCACCCTGCTCCACCTCGTCCGGTCGCAGGTG
GCGGCGGTGCTGGGGCACGGTTCGGCGGAGGCGATCGGCGCTGACCGGGCCTTCCAGGAA
CTGGGCTTCGACTCGCTGGCCGCGACCGAACTGCGCAACCAGCTCAACACGCTGACCGGA
CTGAGGCTGCCCGCCACCCTCGTCTTCGACCACCCCAACGCCCTCGCCGTCACCGATCAC
CTCTCGGCGCGACTGGCCGGGGAGTCCGCGCGGGCGGAGACCCCCGTCCGTACGGGCACG
GCAGCACCGGCCGACGACGAGCCCATCGCCATCGTCGGCATGGCCTGCCGCTACCCCGGC
GGCGTCACCACCCCCGAGGAGCTGTGGCGCCTGGTCACCGACGGCGTCGACACCGTCTCC
GACCTCCCCGGTGACCGGGGCTGGGACATCGAGGGCCTCTACGACCCCGAGCCCGGCAAG
GAGGGCAAGAGCTACACCAGGCGCGGCAGCTTCCTGCACGACGCCGCCCAGTTCGACCCC
GGCTTCTTCGGCATCTCGCCCCGCGAGGCCCTGTACATGGACCCGCAGCAGCGCCTGCTC
CTGGAGACCTCCTGGGAGGCGCTGGAACGCGCCGGGATCGACCCGGCGACGCTGCGGGGC
AGCCGCACCGGCGTCTTCGCCGGCGTCATGTACCACGACTACGCGCTGAACGTCTCGCCC
TCCGGCACCGCCGGCGGCAGCGTGGTCTCCGGCCGCCTGTCGTACACCTTCGGCTGGGAG
GGCCCAGCCGTCACCGTGGACACGGCCTGCTCCTCGTCCCTGGTCGCGCTGCACCTCGCG
GTACAGGCCCTGCGCTCGGGCGAGTGCTCGCTGGCCGTGGCCGGCGGCGCCACCGTGATG
TCGACGCCCGGAATGTTCGTCGAGTTCAGCCGCCAGCGTGGCCTGTCGGTGGACGGCCGC
TGCAAGGCGTTCGCGGGCGCGGCGGACGGCGTGGGCTGGTCCGAGGGCGTCGGCGTCCTC
CTGGTGGAGCGGCTCTCCGACGCCGTGCGCAACGGCCACCGCGTGCTGGCCGTCGTCAAG
GGCACGGCCGTCAACCAGGACGGCGCCTCCAACGGCTTCACCGCCCCCAACGGCCCCTCC
CAGCAGCGCGTGATCCGCCAGGCTCTGCACGGCGCCGGGGTCCCCGCCTCCGAAGTCGAC
GTGGTCGAGGCGCACGGCACCGGCACCACCCTGGGCGACCCCATCGAGGCCCAGGCGCTC
CTCGCCACCTACGGCCAGGACCGCCCCGAGGACCGGCCGCTGCTGCTCGGCTCGGTCAAG
TCCAACATCGGGCACGCCCAGGCCGCGGCGGGAGTCGCCGGCGTCATCAAGATGGTCATG
GCGATGGAGCACGGCACCGTGCCGCGCACCCTTCACGTCGACCGGCCGTCCCCGCACGTC
GACTGGACCGAGGGCCGCGCCGAACTCGTCACCGAGGACCGGCCGTGGCCGGTCACCGGC
CGCCCGCGCCGGGCGAGCGTCTCGGCGTTCGGCCTCAGCGGCACCAACGCGCACGTCGTC
CTGGAACAGGGCCCCGACGCCGCAGCCGACGCGCCGAGCACGGCCGAGGAGGGCCGCGCC
CCCGCCGTCCTCCCGTGGACGGTCTCGGCGGCCACCCCGGACGCCCTGCGCGCCCAGGCC
ACCCGCCTTCTGGACCACCTGGCGGACCGGCCCGGCACCCGTCCGCTGGACGTCGCCCAC
GCGCTGGCCACCTCCCGCACCCCGCTGGAGGCCCGCGCGGTGGTCCTCGGCACCGGCCGG
GACGACCTCCTGACCGGCCTGCGCGCCCTCGCGGCCGGCGAGCACGCCCCCGGGGTCATC
ACCGGAACCGCCCGCTCCGTCGGTACCACGGCCTTCCTCTTCTCCGGGCAGGGCGCACAG
CGCCTGGAGATGGGGCGCGGCCTCCACGAGGCGTTCCCCGTCTTCGCGGAGGCGTTCGAC
GCGGTCTGCGCCGGGCTCGACGAGCACCTGGACCGCCCGCTGCGCGAGGTGGCCTGGGGC
GAGAACGCGCCGGACCTCGACGGCACGGCGTACGCCCAGTCCGCCCTGTTCGCCTACGAA
GTCGCCCTCTTCCGGCTTCTCGCCTCATGGGGCGTCACGCCTGACCTGGTGGCCGGCCAT
TCGATCGGTGAGGTGGCGGCCGCGCATGTGGCGGGTGTGTTCTCGCTGGCGGACGCCTGT
GCTCTGGTGGCTGCTCGTGGGCGGCTGATGCAGGCGTTGCCGGAGGGCGGCGCGATGGTG
GCCGTGGAGGCGTCCGAGACGGAGGTGCTGCCGCATCTGGAGTCCGTCGAAGGTGTGTCG
GTCGCTGCGGTCAACGGTCCGTCGTCGGTGGTCGTCTCGGGCGCCGGGGAAGCCGTTGAG
GCGGTGGCTGAGGTGTTCCGTGAGCAGGGACGGCGGGTCAGCCAGCTGCGGGTGTCGCAC
GCTTTCCACTCGCCGCTGATGGAACCGATGCTCGCTGACTTCCGAGAGGTTCTGTCCGGG
GTGTCGTACGCGGAGCCGTCGCTGCCGGTCGTCTCGAACGTCTCGGGCCGGATCGCGGAG
TCCGGTGAACTGGCCACACCTGACTACTGGGTCACCCACGTCCGCGAGGCCGTCCGCTTC
GGCGACGGCGTCCGGGCACTGCGCGCCGCGGGCGTGGACCGCTGTGTCGAGATCGGCCCC
GACGCCGTACTCACCGGCATGGCCCGCACCTGCCTCGACGGCGACGAGGACACCGCAGTC
CTGCTGGTGCCGTCGGCCCGCAAGGGACGGGAGGAGCCCGACGCCCTGCTCACCGCGCTC
GCGCAGCTGCACACCGCGGGCACGGCCGTCGACTGGGCCGGCTTCTTCGCCGGCTCCGGC
GCCGGCCCCGTCGACCTGCCCACCTACGCCTTCCAGCGCCAGCGGTACTGGCTGACCGCC
ACCGACGGAGCCCCGGCCGCGGCCGGAGCCGGACTCGACGCGGCCGACCATCCGTTGCTG
GGCGCGGTGGTGTCGCTGCCGGACTCCGGAGGCGCGGTGCTGACGGGCCTGCTGTCGGTG
GAGGCGCAGCCGTGGCTTGCCGACCACGTGGTCCTCGGCCGGGTCATGCTGCCCGGCGCC
GTCCTCGTGGAACTGGCCCTCGCCGCCGGAGAGTCCGTCGACTGCGCCGTACTCGACGAA
CTGACCCTGGCGACACCCCTGGTACTTCCCGAGCACGGCGGCGCCCAGGTCCGCGTGGTC
GTCGGACCGCGCACCGCCGAACGCCGCACGGTCGCCGTCTACTCACGCCCCGAGGGCACC
GGGCAGGAGTGGGCCACCCACGCCACCGGCTTCCTCACCGACAACGCCCTCGTGGCAGGG
GCCGAGGCCGCACTGGAGCAGTGGCCGCCGACCGGGGCCGCGAGCGTGCCCGTGGACAGC
GCGTACCAGATCTTCCGCGAGCGTGGCTACGGCTACGGGCCGGTCTTCCAGGGGCTGCGC
GCCGCCTGGCGCCGGGGCGGGGAACTCTTCGCCGAGGTGGCGCTCCCGGAGGAGGCTGCC
TCGGAGGCGGGCCGCTTCGGCCTCCACCCGGCGCTGCTCGACGCCGCCATGCACGTCGCG
ATCCTCAACGACAGCAACGACAGCAACGACAGCAACGACAACGCCGAGGGCGGGAGCGGC
GGGACCGTCATCCCGTTCGCGTGGAACCGGGTCGCCCTGCACGCGGTCGGCGCCGCCGCC
GTCCGCGTCCGGATCGCCACCGCCGCCGACGGCGGTATGGACATCCGCGTCACCGACGTC
ACCGGAGCCCCGGTCCTGACGGTCGGCTCCATGGTGAGCCGCACCGTCTCCGCCGGCCAG
CTCGGTGCGGCGCCCCGTGACGCGGGCGCGCTCTACGCCCCCGAGTGGGTCCCCGTGACC
CGGCTCGACGACACCGACACGGCCTGGGCCACCTGGTCCCGGGTCGAGGAGGCCGGTACC
GAGGTGCCCGCCGTGGTCGTGCTGGACGCCTCCGCTCCGGCCGGGGCCGACGTGCCCGGC
TCGGTGCGCTCCGCGCTGGACGGTGTGCTGACCGTGGCACAGCGCTGGCTGACCGAGGAG
CGGTTCGCCGCCTCCCGGCTCGTCGTGGTGACCCGGGGCGCTATGCCCGTGGGTTCCGGC
GGCGCCCCGGCCGAGGGCGACGTCGTGCAGGCCCCTGTGTGGGGTCTGGTGCGGGCGGCG
CTCGCGGAGAATCCGGGCCGGTTCGCCCTGGCCGATGTCGCCGTGGACGCGGATGATGCG
GCGGTGGACTGTGCGGTCGCGGCTGTCCTCTCGGGCGAGGCCGAGGTCGCCGTCCGGGAC
GGCGTGGTCCTCGTACCGAGGCTGACGCGGCTGACCGCCGACGCACCCGCTGCCGAACTG
CCGCTGTCCGTGCCGTCGTTGGATGGTGAGGGTGCGGTGCTGGTGACGGGTGGTACGGGT
GGTCTGGGTGCGGTGATGGCCCGGTATCTGGTGGCTGAGCGTGGGGTGCGGGATCTGGTG
CTGGTGTCGCGGCGGGGCGGGGACGCCCCGGGTGCGGCGGAGCTGGCCGGGGAACTGCGT
GAGGCCGGTGCGGCGGTGGAGGTCGTCGCGTGCGACCTGTCCGACCGCGAATCGGTCGTG
GACCTCGTCGGCTCTCTCGTCTCCGGGCGCGGGCTGCTGGCCGTGGTCCACGCGGCCGGA
GTCGGTGACAACGGGCTCCTGGGCTCCCTCACTCCCGACCGGTTCGATGCGGTGCTGGGT
GCGAAGGCTGATGCGGCGTGGTGGTTGCACGAGGCGACGGCGGGTGTGGAGCTGGCGGCG
TTCGTGCTGGTGTCGTCGGCGGGTGGTCTGGTGCTGACGGCGGGGCAGGGCAATTACGCG
GCGGCCAATGTGTTCCTGGACGCGTTGGCGTCGCGGCGTCGGGCCGAGGGTCTGGTGGCC
ACGTCCATGGCGTTCGGGTTCTGGGACGTGGGTGCGGGTCTGGGGGAGTATCTGTCGGAG
GTGGACCGGCGTCGGATGGCGTCGCAGGGGCTGCCGTTGCTGTCGCACGAGGCGGGGCTG
GAGCTGTTCGCGGCCGGCCTGGACCGAAGCGAGGCGACCGTCGTGCCGCTGCGCGTCGAC
ACCGCCGCGCTGCGCACCCGCACCGACGAGATCCCCGCCCTCCTGCGCGCGCTGGCTCCC
GCCCGCCGCGCCACCGCGGCCTCGGGTTCGGCTGCCGCGCCGGGCCCGGACGACTCCCCG
TCCCGCAGGCTCGCCGAACTGCCCGCGCCCGAACGGCACCGCGCGGTGCTGCATCTCGTC
CGGTCGCAGGTCGCGGCGGTGCTGGGGCACGGTTCGGCGGAGGCGATCGGCGCTGACCGG
GCATTCCAGGAACTGGGCTTCGACTCCCTGGCCGCGACCGAGCTGCGCAACCAGCTCAAC
ACGCTGACCGGACTGAGGCTGCCCGCCACCCTCGTCTTCGACCACCCCAACGCCCTCGCC
GTCACCGAGGTCGTCGAGGAGGAACTCGCCGCCGCCCACCCCGCCTCCGGCGCGGGCGGT
GCCACCGGCGACGACGACGGGGTGCGCCGCGCCCTCTCCGCCATCCCGGCCCGCCGCCTG
CGTGACGCGGGGCTGGCGGAGACGCTGCTCGAACTCGCCGCGGACTCCGACGAGATGTCC
GACACCGACCGGGACGCCCTGCTCGCCGCCTTCGACGGCGACGACGAGGACGACGCCTCC
GGACCGTACGACGAGAGCGACGGCGCGGCCGAGACCGCCGGGACCGGCACGGCCACCGAA
CCGGGCGCCGACGCGCTCCGTGCCGCCCGTGCCGAGACCGCCCGGCTGCGCCGCGACAAC
CGCAGGCTCACCTCGGCCCAGCACGAACCCATCGCCATCGTCGGCATGGCCTGCCGCTAC
CCGGGCGGCGTCAGCTCGCCCGAGGACCTCTGGCGCCTGGTCACCTCCGGCGACGACGCG
ATCGTCCCCTTCCCCCAGGACCGCGGCTGGGACCTGTCGATCCTCCGCGACCCCGACGGC
GACCACCCGGACGGCCTGTACGCCCGGGAAGGCGGCTTCCTCGACGGGGCGGCCGACTTC
GACCCCGCCTTCTTCGGCATCTCGCCGCGCGAGGCGCTCGGCATGGACCCGCAGCAGCGC
CTGGCACTGGAGATGTCCTGGGAGGCCCTGGAGCGGGCCGGGATCGACCCGGCCTCGCTC
AAGGGCAGCCGGACCGGCGTCTTCACCGGCGTGATGTACCACGACTACCCGGGCAGCGAC
GGCAACGGCAGCGTGGTCACCGGCCGCGTCGCCTACAAGCTCGGACTGGAGGGCCCCGCC
GTCTCCGTCGACACGGCCTGCTCCTCCTCGCTGGTCGCCCTGCACCTCGCCGTGCAGGCG
CTCCGGCAGGGCGAGTGCTCCCTGGCGGTCACCGGTGGTGTCACCGTGCTGTCGACACCG
GCCGTGTTCGCCGAGTTCGGCCGCCAGGGCGGCCTCGCCCCCGACGGCCGCTGCAAGTCC
TTCGCGTCGGCGGCCGACGGCACCGGCTTCTCCGAGGGCGCGGGCTTCCTCGTCGTCGAG
CGGCTCTCCGACGCGGTGCGCAACGGCCACGAGGTACTCGCCGTCGTCCGCGGCTCCGCC
GTCAACCAGGACGGCGCGAGCAACGGCCTCACCGCGCCCAACGGCCCGTCCCAGCGCCGC
GTCATCCGGCAGGCCCTGGCCAACGCCCGGCTCGCCGCCGACCAGGTCGACGCCGTCGAG
GCGCACGGCACCGGCACCACCCTGGGCGACCCCATCGAGGCCCAGGCGCTCCTCGCCACC
TACGGCCAGGACCGCCCCGAGGACCGGCCGCTGCTGCTCGGCTCGGTCAAGTCGAACATC
GGGCACGCCCAGGCCGCGGCGGGAGTCGCCGGCGTCATCAAGATGGTGCTGGCGCTGCGC
AACGGGCTGCTGCCCGCCACGCTGAACGTCGACGCCCCCAGCGACCAGGTCGACTGGACC
ACCGGGTCGGTGGAGCTGCTGACCGAGGCCCGGCAGTGGACCGGCTCCGGCCGCCCGCGC
CGCGCCGGGATCTCCTCCTTCGGGATCAGCGGCACCAACGCCCACGTCATCGTCGAGCAG
GCGCCCGCGGCCGTGCCGTCCGACGAGCCCGCGACCGGCGCGGACGACGACGGCGTCGCC
CCTGTCGTCCCGTGGCTGCTGTCCGCCCGCGACCGGGACGCCCTGCGCGCCCAGGCCGAG
CGGCTCCTCCACCACCTGACGGGGGACCACCCGGCCGCCGGCGGAACCGAGGCGCGCCCG
CTGGACGTCGCCTACTCTCTGGCCACCGCCCGTACCGCGTTCGAGCACCGGGTCGCCGTC
ACGGGCGCCGGCCGGGACGGTCTGCTGGCCGCGCTCGGCTCCGTGGCCCGGGGCGAGGAA
CCGGCCACGACGACCGGTGAGGGGCTGCTCGCCCTCCTCTTCCCGGGGCAGGGCTCCCAG
CGGCTCGGCATGGGCCGCGACCTCTACGAGCGCTTCCCGGTGTTCGCCGAGGCGTTCGAC
GCGGTCTGCGCCGGACTCGACGCGCACCTGGACCGCCCGCTGCGGGAGGTGGTCTGGGGC
GACGACGAGGACGCCCTGAACGCCACCGCCTACGCGCAGGCCGCGCTCTTCGCCCTCGGA
GTGGGCCTCCACCGGCTCGTCGCCTCGTGGGGCGTCACCCCCGACCTGGTGGCGGGCCAC
TCGATCGGCGAGATCGCCGCCGCGCACGTCGCCGGGGTCTTCTCGCTGGCCGACGCCTGC
GCCCTGGTCGCCGCGCGGGGCCGCCTGATGCAGGCACTGCCGGAGGGCGGCGCGATGGCC
GCCGTCCAGGCCACCGAGGACGAGGTGCTCGCGCACCTCACCGACGGGGTCTCGGTCGCC
GCCGTCAACGGACCCACGTCCGTCGTGGTGTCGGGCACCGCCGAAGGGGTGGAGAAGGTG
ACCGAGGCCCTGCGGGAGCGCGGTCGCCGGACGACCGCGCTGCGCGTCTCGCACGCCTTC
CACTCGCCGCTGATGGAACCGATGCTCGCCGAGTTCCGGGCCGTCGTCGCCGGCCTCTCC
CCGCAGGCACCCGTGATACCCGTCGTCTCCAACCTCACCGGGACCACGGCCCGCGCGGAG
GAACTGTGCTCCGCCGAGTACTGGGTGCGCCACGTCCGGGAGGCCGTCCGCTTCGCCGAC
GGCGTCCGGGCCCTGCACGAGGCCGGTGCCACCCGCTACCTGGAACTGGGCCCCGACGGT
GTCGCCTGCGCCATGGCCCGCGAGTCCCTGCCCGAGTCCGCCGTGACGGTCGCCGCCCAG
CGCCGCACCGTCCCCGGCGAGCAGGCCCTGGTCGAGGCGGTCGCCCGGCTGCACGGCCAC
GGTGTCCGCGTCGACTGGCCCGCGTTCTTCGCCGGCCGCGGCGCCCGCCGGGTGGAGCTG
CCCACGTACGCCTTCCAGCGGCGCCGGTTCTGGCCCGCCGGGATGATGCCCCTGGGCGCC
GGGGCGGAGGCCGCCGGGCTCGCGCCCGCCGGCCACCCGCTGCTCGGCGGCGCGGTCGAA
CTGGCCGGCACGGACGGCCACCTGTTCACCGGACGTCTTTCCCAGGGCACCCACGGCTGG
ATCTCCGACCACCGTGTCATGGGCGCCGTCCTGGTGCCCGGCACCGCCCTGCTGGAACTC
GCAGTCCACGCGGGCGGCGTGCTCGGCTGCGACGTGGTGGAGGAACTGACCCTGGCGGCC
CCGCTGGTCCTGCCCGAGCAGGGCACCGTCCAGGTGCAGGTCGGCGTCGGCGCCCCCGAC
GAGGAGGGCCGGCGCGGGATCACCATCCACTCCCGGCCCGCCGACGACTCCGGCGCCCCG
TGGACCTCGCACGCCGAGGGCACCCTGGCCGCCGGACCGGCACAGGCCCCCGCCACCGAC
TTCGACGCCACCGTGTGGCCGCCGGAGAAGGCCGAGCCGCTCGACACCACCGGGCTGTAC
GAGCGTTTCGAGGACGCCGGGTTCGCCTACGGGCCCGTCTTCCAGGGGCTGCGTGCCGCC
TGGAGCCGCGACGGCGAGGTCTTCGCCGAGGCGTCGCTGCCCGACGGCACCGACGGCGAC
GCGTTCACCCTGCACCCGGCGCTCTTCGACGCCGGACTCCACGCCACCGCCCTGGCCGGC
GACGGCGGGGAGTCCGAAGGCACCGGCGGCGTCCCGTTCTCCTGGAACGGGGTCTCCGTG
CACGCCGTGGGCGCCTCCTCGGTACGGCTGCGGCTCTCCCGTACCGACGACGGCACCCTC
GCGATCGCCGTCACCGACACCGCCGGCACCCCGGTCGCCTCGGTCGGGTCCCTGGTGACC
CGCCCGCTCTCCGCCGGGCAGTTCGGCGGCGCGGGCGGCGCGGGCCGCGACTCCCTGTTC
CAGCTGGACTGGGCGGCTGCCGGGGACCCCGCCACGCGGGACGCCGAGACGCCCGGCCCG
GTCGCCGTGCTCGGCCCGGACACCGCGCTCCTCGGCGGCGGCGACCTCCTCGCCGAAGCC
GGGACGGAGGGCGTGACCGGTCTGGCGGACCTCGTCACCGGCACCGGGCCCGGGGAGGAC
GTGCCGTCCGTGGTGCTGCTGCCGGTCGCCACCGCCCCGGAGGCCGGGTCCGGCACCGGG
GACGTGGCCGCCGCCGCCCACGCCGCCACCGCCCGGGTCCTGGAGACCCTCCGCGACTGG
TCGGCCCAGGAGCGGTTCGCCGCCTCCCGCCTGGTCGTCGTCACCCGGGGTGCCTCCGAC
GGCGCCGACCCGGCCGCCGCGGCGGTCTGGGGGCTGGTGCGCGCCGCGCAGGCGGAGAAC
CCGGGCCGGTTCATCCTCCTCGACCTGGAGCCCTCGGCCACCTCTCCGCTCGGGATGTCC
GCCCTGCGGGCGGCGCTGGCCTCGGGCGAACCGCAGCTCGCCCTGCGCGAGGACCGCCTG
CTGGCACCTCGCCTGGTGCGCGCGGTGACGCCCGCCGAGAGCGACGCGGCCGGCTGGGAC
CCGGAGGGCACCGTGCTGATCACGGGCGGCACCGGCGGCCTCGGCGCCACCGTCGCCCGG
CACCTGGTCGCCGAGCACGGGGTCCGGAGCCTGCTCCTGGTCAGCCGTCGTGGTCCGGCC
GCCGAGGGTGCCGGTGAACTGGCCGCCGCGCTGGAGGAGTCCGGCGCCCACGTCACCGTC
GCCGCCTGCGACGTCGGCGACCGTACGGCCGTCGACGCGCTGCTGGCGGAGATCCCCGCC
GACCGTCCGCTGCGGGCGGTGATCCACGCGGCCGGTGTCCTGGACGACGGGGTTCTCGAC
TCCCTCACCCCGGAACGCCTCGCCGCCGTGCTGCGGCCCAAGGCGGACGCCGCCTGGCAC
CTCCACGAGGCGACCGAGGGGCTTACGCTCGACGCCTTCGTGCTCTTCTCCTCCGTCGCC
GGCACGCTCGGCAGCGCGGGACAGGCCAACTACGCGGCGGGCAACGCCTTCCTCGACGCA
CTGGCCCGCCACCGCCGGGACCGTGGACTGCCCGCGGTGTCGATGGCCTGGGGCCCGTGG
ACCCGGGGGAGCGGCATGACCGGTGAGCTGACCGAGGCGGACACCGCCCGGATGGCGCGG
GCGGGCATGCCCCCGATCGACCCCGAGCAGGGCCTGGCCCTGTTCGACGCGGTCACCGGC
GCCGCCGAGCAGGCCCCGGCCGTCCTCCCGGTCCGGCTCGACCTGGGGGCCCTGCGCTCC
CTCGGCGAGGTGCCGCCGCTGTTCCGGTCACTGATCCGGACCCAGGCCCGCCGTGCCGCC
TCCGACGGGGGAGCGGCGGCCGCCGCCGACCTCACCCGGCGCCTCACCGGCCTCACCCGG
ACCGAGGGCGAGGAGGTCCTGCTGGACCTGGTACGCGGCCAGATCGCGACCGTACTGGGC
CACGCGGGCCAGGCCGACATCGAACCCGCCCGTGCCTTCCAGGACCTGGGCTTCGATTCG
CTGACCTCGGTCGAGCTGCGGAACCGGCTCGGCGCGCTCACCGGGGTGCGGCTCCCGGCC
ACGCTGCTGTTCGACTACCCGACGCCCGGCGAACTCGTCGCCCACCTGTACACGCGGGTG
GCCCCGGCACCGGCCGACGGGTCGGCGGTGGTCCTGGCGGAACTGGACAAGCTGGAGAGG
GCTTTCGCGGGCGCCGAGGTCGGCGCCGAGCTCTTCGACCAGGTGGCGGGCCGGCTGGAG
GTTCTCCGCGGCAAGTGGCAGGAGATGCGGGCCGAGGCCCTCAAGGGCGGGGAGAAGGCG
GAGGAGTCCTTCGACTTCGCCTCCGCCTCCGACGAGGACATGTTCGACATGCTCGACAAC
GAACTCGGACTCTCCTGA
[5] KS35..410
[5] AT578..891
[5] malonyl-CoA766..770
[5] DH940..1102
[5] KR1417..1593
[5] ACP1694..1764
[6] KS1788..2162
[6] AT2320..2633
[6] malonyl-CoA2508..2512
[6] DH2682..2849
[6] KR3155..3335
[6] ACP3436..3506
[7] KS3530..3904
[7] AT4061..4373
[7] malonyl-CoA4247..4251
[7] DH4419..4585
[7] KR4884..5060
[7] ACP5161..5231
[8] KS5254..5628
[8] AT5777..6091
[8] malonyl-CoA5965..5969
[8] DH6139..6300
[8] KR6590..6770
[8] ACP6872..6942
[9] KS6966..7334
[9] AT7492..7809
[9] malonyl-CoA7680..7684
[9] DH7857..8019
[9] KR8331..8511
[9] ACP8616..8686
[10] KS8809..9171
[10] AT9333..9644
[10] malonyl-CoA9518..9522
[10] DH9692..9857
[10] KR10183..10363
[10] ACP10467..10537
[5] KS103..1230
[5] AT1732..2673
[5] malonyl-CoA2296..2310
[5] DH2818..3306
[5] KR4249..4779
[5] ACP5080..5292
[6] KS5362..6486
[6] AT6958..7899
[6] malonyl-CoA7522..7536
[6] DH8044..8547
[6] KR9463..10005
[6] ACP10306..10518
[7] KS10588..11712
[7] AT12181..13119
[7] malonyl-CoA12739..12753
[7] DH13255..13755
[7] KR14650..15180
[7] ACP15481..15693
[8] KS15760..16884
[8] AT17329..18273
[8] malonyl-CoA17893..17907
[8] DH18415..18900
[8] KR19768..20310
[8] ACP20614..20826
[9] KS20896..22002
[9] AT22474..23427
[9] malonyl-CoA23038..23052
[9] DH23569..24057
[9] KR24991..25533
[9] ACP25846..26058
[10] KS26425..27513
[10] AT27997..28932
[10] malonyl-CoA28552..28566
[10] DH29074..29571
[10] KR30547..31089
[10] ACP31399..31611

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [570-699]  G3DSA:3.40.366.10 [766-881]  G3DSA:3.40.366.10 [2314-2441]  G3DSA:3.40.366.10 [2508-2622]  G3DSA:3.40.366.10 [4054-4182]  G3DSA:3.40.366.10 [4247-4362]  G3DSA:3.40.366.10 [5771-5898]  G3DSA:3.40.366.10 [5965-6080]  G3DSA:3.40.366.10 [7490-7610]  G3DSA:3.40.366.10 [7679-7791]  G3DSA:3.40.366.10 [9328-9453]  G3DSA:3.40.366.10 [9518-9633]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [6590-6757]  5.59999999999999e-50 PF00106 [8331-8498]  2.4e-51 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1722-1737]  PS00012 [3464-3479]  PS00012 [5189-5204]  PS00012 [6900-6915]  PS00012 [8644-8659]  PS00012 [10495-10510]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1691-1767]  G3DSA:1.10.1200.10 [3433-3509]  G3DSA:1.10.1200.10 [5158-5232]  G3DSA:1.10.1200.10 [6870-6946]  G3DSA:1.10.1200.10 [8614-8690]  G3DSA:1.10.1200.10 [10466-10541]  G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1694-1764]  PS50075 [3436-3506]  PS50075 [5161-5231]  PS50075 [6872-6942]  PS50075 [8616-8686]  PS50075 [10467-10537]  PS50075
PS50075   ACP_DOMAIN
 [1698-1763]  2.3e-11 PF00550 [3440-3505]  2.3e-11 PF00550 [5165-5230]  2.5e-09 PF00550 [6876-6941]  1.2e-09 PF00550 [8620-8682]  5.20000000000001e-09 PF00550 [10470-10536]  1.7e-12 PF00550
PF00550   PP-binding
 [1687-1804]  1.89999859865865e-30 SSF47336 [3429-3546]  1.10000150671642e-30 SSF47336 [5154-5270]  5.39999384454126e-28 SSF47336 [6865-6983]  3.60000433965927e-27 SSF47336 [8609-8825]  5.49999338756182e-23 SSF47336 [10459-10554]  8.40001703163684e-23 SSF47336
SSF47336   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1417-1592]  1.2e-62 PF08659 [3155-3334]  3.89999999999997e-62 PF08659 [4884-5059]  3.40000000000004e-58 PF08659 [10183-10362]  1.29999999999998e-66 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-284]  9.3000000000001e-95 PF00109 [1788-2036]  6.29999999999998e-95 PF00109 [3530-3778]  1.5e-96 PF00109 [5254-5502]  2.20000000000002e-94 PF00109 [6966-7208]  2.20000000000002e-95 PF00109 [8809-9045]  8.19999999999987e-89 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-410]  2.70000000000002e-44 PF02801 [2044-2162]  1.09999999999999e-47 PF02801 [3786-3904]  6.6999999999999e-48 PF02801 [5510-5628]  6.6999999999999e-48 PF02801 [7216-7334]  1.29999999999998e-47 PF02801 [9053-9171]  1e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [578-891]  7.30000000000007e-66 PF00698 [2320-2633]  3.99999999999998e-66 PF00698 [4061-4373]  2.20000000000002e-67 PF00698 [5777-6091]  1.99999999999999e-63 PF00698 [7492-7810]  7.69999999999997e-60 PF00698 [9333-9644]  6.09999999999996e-61 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [3-26]  5.5e-10 PF08990
PF08990   Docking
 [3-35]  2.59999946718995e-06 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [574-883]  1.19999063421924e-74 SSF52151 [2316-2625]  3.699978135861e-76 SSF52151 [4057-4364]  6.00001679190159e-79 SSF52151 [5773-6082]  3.699978135861e-75 SSF52151 [7488-7797]  2.99998750445706e-73 SSF52151 [9328-9635]  1.39999277195148e-74 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [701-765]  4.80000830876748e-19 SSF55048 [2443-2507]  9.39998942703831e-19 SSF55048 [4184-4246]  3.60000433965927e-17 SSF55048 [5900-5964]  1.70000295590054e-17 SSF55048 [7615-7679]  5.10001002358244e-18 SSF55048 [9455-9517]  1.89999859865865e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [35-295]  G3DSA:3.40.47.10 [296-462]  G3DSA:3.40.47.10 [1790-2048]  G3DSA:3.40.47.10 [2049-2213]  G3DSA:3.40.47.10 [3532-3790]  G3DSA:3.40.47.10 [3791-3955]  G3DSA:3.40.47.10 [5256-5514]  G3DSA:3.40.47.10 [5515-5680]  G3DSA:3.40.47.10 [6969-7220]  G3DSA:3.40.47.10 [7221-7385]  G3DSA:3.40.47.10 [8811-9057]  G3DSA:3.40.47.10 [9058-9223]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-408]  5.10003242202156e-102 SSF53901 [1780-2160]  2.1000026783403e-102 SSF53901 [3522-3902]  2.50000909916183e-104 SSF53901 [5246-5680]  1e-103 SSF53901 [6959-7332]  1.59998835313644e-103 SSF53901 [8801-9167]  1.09999184471405e-100 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1416-1593]  G3DSA:3.40.50.720 [3155-3338]  G3DSA:3.40.50.720 [4886-5066]  G3DSA:3.40.50.720 [6591-6787]  G3DSA:3.40.50.720 [8332-8541]  G3DSA:3.40.50.720 [10183-10394]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [1949-1965]  PS00606 [3691-3707]  PS00606 [5415-5431]  PS00606 [7121-7137]  PS00606 [8958-8974]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [579-872]  3.10001307370203e-127 SM00827 [2321-2614]  9.40003071030835e-129 SM00827 [4062-4353]  1.09999184471405e-123 SM00827 [5778-6071]  1.39999277195148e-126 SM00827 [7493-7790]  7.80005155399507e-125 SM00827 [9333-9624]  8.19994104549873e-126 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1695-1767]  1.3000049540733e-35 SM00823 [3437-3509]  1.3000049540733e-35 SM00823 [5162-5234]  1.70000295590053e-33 SM00823 [6873-6945]  4.50001022902825e-33 SM00823 [8617-8689]  4.09999599045784e-30 SM00823 [10468-10540]  1.20000117458134e-32 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [940-1102]  2.0000139277205e-84 SM00826 [2682-2849]  8.89993011983204e-91 SM00826 [4419-4585]  4.69998262513189e-87 SM00826 [6139-6300]  3.19999899046355e-80 SM00826 [7857-8019]  1.19999063421924e-74 SM00826 [9692-9857]  1.19999063421924e-86 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-462]  SM00825 [1790-2214]  SM00825 [3532-3956]  SM00825 [5256-5680]  SM00825 [6969-7386]  SM00825 [8811-9223]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1417-1593]  2.1000026783403e-60 SM00822 [3155-3335]  6.70002630158883e-62 SM00822 [4884-5060]  1.49999648196323e-54 SM00822 [6590-6770]  4.50001022902825e-44 SM00822 [8331-8511]  9.10000425645573e-46 SM00822 [10183-10363]  1.3000049540733e-65 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit