close all open/close all

CDS information : FR008_00180


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction84,132 / 77,983 / - [in whole cluster]
84,132 / 77,983 / - [in contig]
Locationcomplement(77983..84132) [in whole cluster]
complement(77983..84132) [in contig]
TypeCDS
Length6,150 bp (2,049 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)FscF
Gene
Gene (GenBank)fscF
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
[18559273] Incomplete beta-ketone processing as a mechanism for polyene structural variation in the FR-008/candicidin complex. (Chem Biol. , 2008)

close this sectionPKS/NRPS Module

21 malonyl-CoA
KS34..406
AT548..868
dh915..1073
KR1378..1558
ACP1666..1736
TE1820..1918

close this sectionSequence

selected fasta
>polyketide synthase [FscF]
MPDDKKLVDYLKWVTADLHKTRRRLEEAEAHRREPIAVVGMACRLPGGVATPEEYWRLLE
EGRDGIAPFPADRGWDLDALNGEGAGSSAAGEGGFVDAAAFDAGFFGISPREAVAMDPQQ
RILLETTWEAVERAGIDPVSLRGSRTGVYVGTAGVDYVGVVMNSREDAEGHATTGLTASV
VSGRLSYAFDLAGPAVTVDTACSASLVAIHLAAQALRNGECGLALAGGVTVMSTPMGFSG
FTRQGGISTSGRCKAFADSADGTGWAEGAGVLVLERLSDARRNGHQVLAVVRGSAVNQDG
ASNGLTAPNGPSQQRVIRQALAGAGLSAADVDAVEAHGTGTPLGDPIEAQALLATYGQDR
PEDRPLLLGSVKSNIGHSQAAAGVAGVIKTVLAIQHGVLPRSLHIDEASSHVDWGAGNVR
LLTENTAWPETGRPRRAGVSSFGISGTNAHVVIEQAPEPEEPATPEDGTPTARPTLVPWP
VSAKTREALDAQLARVTSVTGAAPLDIGHSLATGRSTFEHRAVLLAGPEGEPAEAARGRA
TERTLALLFSGQGSQRAGMGRELYERFPVFAEALDAVVARLDTGLERSLREVLFVEEGSE
AAALLDVTGYTQPALFAVEVALFRLVESWGVSPEFVAGHSVGEIAAAHVAGVFSLDDACR
LVAARARLMQELPTGGAMVAVRATEAEVTPRLTEGLSLAAVNGPDSVVVSGPEGEVTALA
AEFETEGRKIQRLSVSHAFHSALMEPMLDAFREVARSLEYAEPRVPVVSNVTGALAAPGQ
LTDPEYWVRHVRETVRFADGVRTLAEAGADAFLEIGPGGVLTALARQSLDTLDGGTGAVA
APALRSRRPEQEALLTGLAQLHVAGVRVDWAAWFTGTGARRTDLPTYAWQHRRYWPRPLA
HAADIPGAGLTPAEHPLLGAAVSLAGSEGVLLTGRVGLRTHPWLADHVMGGLVLFPATAF
LELAVRAGDQAGCGRVQELTLTTPLALDPRGAASVQVGVGPPDAAGCRPLAIHSRPEDAA
DDEPWTQHATGVLVAGARQVAFGQSAWPPADATPVDLDGFYERTEYGPLFQGLRAVWTRG
DEVLAELELPARADDAALFGLHPALLTAALHAVEYVELKDADQGLLPFSWSGVTLHASGA
ARLRVRITKAGEDTVSIAAVDTAGRPVLSVESLALRPSGAARLLKPGTDRSTLLGLDWVP
AEPTGPAAGGPRVALGTDPFGTGTVLAGLDEVTETGTQVLVPVPDGGEDPVTATHEATRA
TLALLQEWLDGPRPAGARLVFVARGVVAARPGDPAANLAGAAVWGMVRTAQAEHPADFTL
VDVEPGAPFPLEAVLAVDEPQAAVRDGQVLVGRLTQLPPPTPQDGPENTDPFGVTRDGTV
LVTGGTGTLGARTARHLVTRHGVTRLLLAGRRGPDAPGAAALREELTALGAHVTVAACDV
SDRDALAALLGGIPAEHPLTAVVHAAGVLDDAVVTSLTPDRLATVLRSKADAAWHLHDLT
RGLGLDAFVLYSSISGVTARAGQANYVAANLFLDTLAQHRAAQGLPALSVAWGAWDLDEG
MAGDLLTDTGRRRIRSGGIDTLPGDRALDLLDTALTLGEPLVVATNLAAPPATAHLDEVP
PLMRGLVRPPRRTAAATTDAPARVLDAASFRENFANLGAGEQETTLRETVVACAAALLGH
TDTSEIDPDRDFLELGFDSLIGIELRRKLSEITGLQLPASIVYDSGSPNGLTAWLRTELG
AQGSGAPQTGAAGGPTENDSMERLFLDGLAQGKVREAQRMLATVAALRPSFEVTAELEDL
PWPVTLAEGPAPTRLVCVSAPTANGGVHQYATLSGHFRGRRDVTALPLIGFNTGEALPAH
AEAAARIIADCTLQAADGKPFVLVGHSSGGSLAYAAAGVLEHTWGIRPEAVVLLDTLSIQ
HKSDEGVDYNGMMKFNFTAVDDSPVRLTNSRLSAMGRWMVLLNALDVHPTTVPVLEIKCT
RALIEGVPAPDPERLHLPVVPDAEVRPLDSDHLSLIREDSGPAADLMDAWLTALETTATT
DAPETAPAG
selected fasta
>polyketide synthase [FscF]
ATGCCCGATGACAAGAAGCTCGTCGACTACCTCAAGTGGGTCACGGCCGATCTGCACAAG
ACCCGCCGGCGGCTGGAGGAGGCGGAGGCCCACCGCCGCGAACCCATCGCGGTCGTCGGC
ATGGCCTGCCGGCTGCCCGGAGGCGTCGCGACCCCCGAGGAGTACTGGCGGCTCCTGGAG
GAGGGCCGTGACGGCATCGCGCCCTTCCCCGCCGACCGGGGCTGGGACCTCGACGCCCTG
AACGGCGAGGGCGCCGGCAGCAGCGCGGCGGGCGAGGGCGGCTTCGTCGACGCCGCCGCC
TTCGACGCGGGCTTCTTCGGGATCTCGCCCCGCGAGGCGGTCGCCATGGACCCGCAGCAG
CGGATCCTGCTGGAGACCACCTGGGAGGCGGTGGAGAGGGCGGGCATCGACCCGGTCTCC
CTGCGCGGCAGCCGCACCGGCGTCTACGTCGGCACGGCCGGCGTCGACTACGTCGGCGTC
GTCATGAACTCCCGGGAGGACGCCGAGGGCCACGCCACCACCGGCCTCACCGCCAGCGTG
GTCTCCGGCCGCCTGTCGTACGCCTTCGACCTCGCCGGGCCCGCCGTCACCGTCGACACC
GCCTGCTCCGCCTCGCTGGTCGCCATCCACCTGGCGGCCCAGGCGCTGCGCAACGGCGAG
TGCGGCCTCGCCCTGGCGGGCGGCGTCACCGTGATGTCCACCCCGATGGGCTTCTCGGGC
TTCACCCGCCAGGGCGGCATCTCCACCAGCGGCCGCTGCAAGGCGTTCGCCGACTCCGCC
GACGGGACCGGCTGGGCCGAGGGCGCCGGCGTCCTCGTCCTGGAACGGCTCTCCGACGCC
CGCCGCAACGGCCACCAGGTACTGGCCGTGGTGCGCGGCTCGGCCGTCAACCAGGACGGT
GCCTCCAACGGGCTGACCGCCCCCAACGGCCCGTCCCAGCAGCGCGTCATCCGCCAGGCC
CTGGCGGGCGCCGGACTCTCCGCCGCCGACGTGGACGCCGTGGAGGCACACGGGACGGGC
ACCCCGCTGGGCGACCCGATCGAGGCGCAGGCGCTGCTGGCGACGTACGGGCAGGACCGG
CCCGAGGACCGGCCGTTGCTGCTCGGCTCGGTGAAGTCGAACATCGGGCACTCCCAGGCC
GCCGCCGGCGTCGCGGGCGTCATCAAGACCGTGCTCGCCATCCAGCACGGCGTCCTTCCC
CGCTCCCTCCACATCGACGAGGCCTCCAGCCACGTCGACTGGGGCGCGGGCAACGTCCGC
CTGCTCACCGAGAACACCGCCTGGCCCGAGACCGGCCGCCCCCGCCGTGCCGGGGTCTCC
TCCTTCGGCATCAGCGGCACCAACGCCCACGTCGTGATCGAGCAGGCGCCCGAGCCCGAG
GAGCCCGCGACGCCCGAGGACGGGACGCCCACCGCCAGGCCCACCCTCGTCCCCTGGCCG
GTGTCCGCGAAGACCCGCGAGGCGCTCGACGCGCAGCTCGCCCGCGTCACCTCGGTCACC
GGCGCCGCGCCGCTCGACATCGGTCACTCCCTGGCCACCGGACGCTCCACCTTCGAACAC
CGTGCGGTGCTCCTCGCGGGCCCCGAGGGCGAACCGGCCGAGGCCGCGCGGGGACGGGCC
ACCGAGCGCACACTCGCTCTCCTCTTCTCGGGCCAGGGTTCGCAGCGTGCGGGGATGGGC
CGGGAGTTGTACGAGCGTTTCCCGGTGTTCGCGGAGGCGCTTGACGCGGTGGTGGCCCGT
CTGGACACGGGGCTGGAGCGTTCGCTGCGGGAGGTGCTGTTCGTGGAGGAGGGCTCCGAG
GCGGCGGCGCTGCTGGACGTGACCGGGTACACGCAGCCGGCGCTGTTCGCGGTGGAGGTG
GCGCTGTTCCGGCTGGTGGAGTCGTGGGGTGTCTCGCCGGAGTTCGTGGCGGGGCATTCG
GTCGGTGAGATCGCGGCGGCGCACGTGGCGGGGGTCTTCTCGCTCGACGACGCCTGCCGG
CTGGTCGCCGCCCGCGCCCGCCTGATGCAGGAACTCCCCACGGGCGGGGCGATGGTGGCC
GTACGGGCGACGGAGGCCGAGGTGACGCCCCGGCTGACCGAGGGCTTGTCCCTGGCCGCC
GTGAACGGTCCCGACTCCGTCGTCGTGTCCGGTCCCGAAGGTGAAGTGACGGCCCTCGCC
GCCGAGTTCGAGACCGAAGGGCGGAAGATCCAGCGTCTGTCCGTCAGCCACGCCTTCCAC
TCGGCGCTGATGGAGCCGATGCTCGACGCCTTCCGCGAGGTCGCCCGCTCGCTGGAGTAC
GCCGAGCCGCGCGTCCCGGTGGTCTCCAACGTCACCGGCGCCCTCGCCGCGCCCGGTCAG
CTCACCGACCCCGAGTACTGGGTGCGGCACGTCCGCGAGACCGTCCGCTTCGCCGACGGC
GTCCGTACCCTCGCCGAGGCGGGAGCCGACGCCTTCCTGGAGATCGGCCCCGGCGGGGTC
CTGACCGCCCTCGCCCGGCAGAGCCTCGACACGCTCGACGGCGGTACCGGCGCCGTGGCA
GCCCCGGCGCTGCGCTCCCGCCGCCCCGAGCAGGAGGCCCTGCTCACCGGTCTCGCCCAG
CTGCACGTCGCGGGTGTCCGCGTCGACTGGGCCGCCTGGTTCACCGGTACCGGCGCCCGC
CGCACCGACCTGCCCACGTACGCCTGGCAGCACCGCCGCTACTGGCCGCGCCCGCTCGCC
CACGCCGCCGACATCCCCGGGGCCGGGCTCACCCCGGCCGAGCACCCCCTGCTCGGTGCC
GCGGTCTCCCTCGCCGGTTCCGAGGGCGTCCTGCTGACCGGGCGCGTGGGCCTGCGCACC
CATCCCTGGCTCGCCGACCACGTCATGGGCGGCCTCGTCCTCTTCCCCGCCACGGCCTTC
CTCGAACTCGCCGTCCGCGCGGGCGACCAGGCCGGCTGCGGCCGCGTCCAGGAACTGACC
CTCACCACCCCGCTCGCCCTCGACCCGCGAGGCGCCGCCTCCGTACAGGTCGGCGTCGGT
CCCCCCGACGCGGCCGGCTGCCGCCCGCTCGCCATCCACTCCCGGCCCGAGGACGCCGCC
GACGACGAGCCCTGGACCCAGCACGCCACCGGCGTCCTGGTCGCCGGAGCACGCCAGGTC
GCCTTCGGCCAGAGCGCCTGGCCCCCCGCCGACGCCACCCCCGTCGACCTGGACGGCTTC
TACGAGCGCACCGAGTACGGCCCGCTCTTCCAGGGGCTGCGTGCCGTGTGGACCCGGGGC
GACGAGGTCCTCGCCGAACTCGAACTGCCCGCCCGCGCCGACGACGCCGCCCTCTTCGGT
CTCCACCCCGCCCTGCTCACCGCCGCCCTCCACGCCGTGGAGTACGTCGAGCTGAAGGAC
GCCGACCAGGGACTCCTGCCGTTCTCCTGGTCCGGCGTCACCCTGCACGCCTCCGGGGCC
GCCCGGCTCCGGGTCCGTATCACCAAGGCCGGTGAGGACACCGTCAGCATCGCCGCCGTC
GACACCGCCGGCCGGCCCGTGCTGTCGGTCGAGTCGCTGGCCCTGCGGCCCTCCGGGGCG
GCCCGCCTGCTCAAGCCCGGAACCGACCGCTCCACCCTCCTCGGCCTCGACTGGGTCCCC
GCCGAACCCACCGGGCCCGCCGCCGGAGGCCCCCGGGTCGCCCTCGGCACCGACCCGTTC
GGCACCGGTACGGTCCTGGCCGGGCTCGACGAGGTCACCGAGACGGGCACCCAGGTCCTC
GTACCCGTCCCCGACGGAGGCGAGGACCCGGTCACCGCCACCCACGAGGCGACCCGCGCC
ACCCTCGCCCTCCTCCAGGAGTGGCTGGACGGCCCCCGCCCGGCGGGCGCCCGGCTGGTC
TTCGTCGCACGCGGCGTCGTGGCCGCCCGTCCCGGCGACCCGGCCGCCAACCTGGCCGGG
GCCGCGGTGTGGGGCATGGTCCGCACCGCCCAGGCCGAGCACCCCGCCGACTTCACCCTG
GTCGACGTCGAACCGGGCGCCCCGTTCCCCCTGGAGGCCGTCCTCGCCGTCGACGAGCCG
CAGGCCGCCGTCCGCGACGGACAGGTCCTCGTCGGCCGCCTCACCCAACTGCCCCCGCCC
ACGCCCCAGGACGGCCCGGAGAACACCGACCCGTTCGGTGTCACCCGTGACGGCACCGTC
CTGGTGACCGGAGGCACCGGCACCCTCGGCGCCCGCACCGCCCGCCACCTCGTCACCCGC
CACGGCGTCACCCGGCTCCTGCTGGCGGGCCGCCGGGGCCCCGACGCCCCCGGCGCCGCC
GCCCTGCGCGAGGAACTGACCGCCCTCGGCGCCCATGTCACCGTCGCCGCCTGCGACGTC
TCCGACCGCGACGCCCTGGCCGCACTGCTCGGCGGCATCCCCGCCGAGCACCCGCTCACC
GCCGTCGTGCACGCCGCCGGAGTCCTCGACGACGCCGTCGTCACCTCCCTCACACCGGAC
CGCCTGGCCACCGTCCTGCGGTCCAAGGCGGACGCCGCCTGGCACCTGCACGACCTCACC
CGCGGCCTCGGCCTCGACGCCTTCGTCCTCTACTCCTCCATCTCCGGCGTCACCGCCCGC
GCCGGCCAGGCCAACTACGTCGCCGCCAACCTCTTCCTCGACACCCTCGCCCAGCACCGG
GCCGCCCAGGGCCTGCCGGCCCTCTCCGTGGCCTGGGGCGCCTGGGACCTCGACGAGGGC
ATGGCCGGCGACCTCCTCACCGACACCGGCCGCCGCCGCATCCGCTCCGGCGGCATCGAC
ACCCTGCCCGGCGACCGCGCCCTGGACCTTCTCGACACCGCGCTCACGCTCGGCGAACCC
CTGGTGGTCGCCACCAACCTGGCCGCACCGCCCGCCACCGCCCACCTCGACGAGGTGCCG
CCGCTCATGCGGGGCCTGGTCCGTCCCCCGCGCCGGACCGCCGCCGCCACGACCGACGCC
CCGGCCCGCGTCCTGGACGCGGCCTCCTTCCGCGAGAACTTCGCGAACCTCGGCGCGGGG
GAGCAGGAGACCACCCTGCGCGAGACGGTCGTGGCCTGCGCCGCGGCACTCCTCGGCCAC
ACCGACACCTCGGAGATCGACCCCGACCGCGACTTCCTGGAGCTCGGCTTCGACTCCCTG
ATCGGTATCGAACTGCGCCGCAAGCTCAGCGAGATCACCGGTCTCCAGCTCCCCGCGAGC
ATCGTCTACGACAGCGGCTCCCCGAACGGGCTCACCGCCTGGCTGCGCACCGAACTCGGC
GCCCAGGGCAGCGGCGCCCCGCAGACCGGCGCCGCCGGCGGCCCCACCGAGAACGACTCC
ATGGAGCGGCTGTTCCTCGACGGCCTGGCCCAGGGCAAGGTGCGCGAGGCACAGCGCATG
CTGGCCACCGTCGCGGCGCTGCGCCCCTCCTTCGAGGTGACCGCCGAACTGGAGGACCTG
CCCTGGCCGGTGACGCTCGCCGAGGGCCCCGCACCGACCCGCCTGGTGTGCGTCAGCGCC
CCCACCGCCAACGGCGGCGTCCACCAGTACGCCACTCTCTCCGGCCACTTCCGGGGCCGC
CGCGACGTCACCGCGCTGCCCCTCATCGGCTTCAACACCGGCGAGGCCCTGCCCGCCCAC
GCCGAGGCGGCCGCGCGGATCATCGCCGACTGCACCCTCCAGGCCGCCGACGGCAAGCCC
TTCGTCCTGGTCGGCCACTCCTCCGGCGGCTCCCTCGCCTACGCGGCGGCCGGAGTCCTG
GAACACACCTGGGGCATCCGGCCCGAGGCCGTCGTCCTCCTCGACACCCTCAGCATCCAG
CACAAGAGCGACGAGGGCGTCGACTACAACGGCATGATGAAGTTCAACTTCACCGCCGTC
GACGACTCCCCGGTGCGCCTGACCAACTCCCGCCTGTCCGCCATGGGCCGCTGGATGGTG
CTCCTCAACGCCCTCGACGTGCACCCCACCACCGTCCCCGTCCTGGAGATCAAGTGCACC
CGGGCGCTCATCGAGGGCGTCCCCGCCCCCGACCCCGAGCGCCTGCACCTTCCGGTCGTC
CCCGACGCGGAGGTCCGCCCCCTGGACTCCGACCACCTCTCCCTCATCCGTGAGGACTCC
GGCCCCGCCGCCGACCTCATGGACGCGTGGCTGACCGCCCTGGAGACCACGGCCACCACC
GACGCGCCGGAGACCGCCCCCGCCGGCTGA
[21] KS34..406
[21] AT548..868
[21] malonyl-CoA737..741
[21] dh915..1073
[21] KR1378..1558
[21] ACP1666..1736
[21] TE1820..1918
[21] KS100..1218
[21] AT1642..2604
[21] malonyl-CoA2209..2223
[21] dh2743..3219
[21] KR4132..4674
[21] ACP4996..5208
[21] TE5458..5754

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [1820-1918]  2.3e-17 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [540-672]  1.20000000000001e-83 G3DSA:3.40.366.10 [737-856]  1.20000000000001e-83 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1694-1709]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1666-1736]  PS50075
PS50075   ACP_DOMAIN
 [1659-1757]  5.69999708783953e-19 SSF47336
SSF47336   ACP_like
 [1665-1740]  2.5e-15 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1669-1735]  7.7e-11 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [1378-1556]  1.99999999999999e-60 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-280]  7.20000000000003e-89 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [288-406]  5.89999999999994e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [548-868]  1.39999999999997e-69 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  1.6e-13 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [544-833]  6.80004680300024e-73 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [674-736]  2.00000075217456e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-292]  1.99999999999999e-88 G3DSA:3.40.47.10 [293-460]  1.9e-66 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-458]  1.79999754022378e-96 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1376-1564]  1.5e-35 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [193-209]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [548-848]  3.699978135861e-127 SM00827
SM00827   PKS_AT
IPR020802 Polyketide synthase, thioesterase domain (Domain)
 [1816-2031]  8.99992502689852e-94 SM00824
SM00824   PKS_TE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1667-1739]  7.30000590915208e-25 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [915-1073]  2.1000026783403e-80 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-458]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1378-1558]  2.50000909916183e-58 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit