close all open/close all

CDS information : FR008_00190


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction107,485 / 84,170 / - [in whole cluster]
107,485 / 84,170 / - [in contig]
Locationcomplement(84170..107485) [in whole cluster]
complement(84170..107485) [in contig]
TypeCDS
Length23,316 bp (7,771 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)FscE
Gene
Gene (GenBank)fscE
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
[18559273] Incomplete beta-ketone processing as a mechanism for polyene structural variation in the FR-008/candicidin complex. (Chem Biol. , 2008)

close this sectionPKS/NRPS Module

17 malonyl-CoA
18 malonyl-CoA
19 malonyl-CoA
20 malonyl-CoA
KS35..410
AT551..866
dh914..1071
er1385..1687
KR1697..1877
ACP1980..2050
KS2072..2448
AT2593..2912
DH2960..3118
ER3429..3731
KR3741..3921
ACP4023..4093
KS4118..4494
AT4636..4952
kr5263..5442
ACP5550..5620
KS5643..6019
AT6161..6480
DH6527..6684
ER7018..7320
KR7330..7509
ACP7613..7683

close this sectionSequence

selected fasta
>polyketide synthase [FscE]
MTTPSEKVVEALRASLKETERLRRQNRDLAAAASEPVAVVAMSCRYPGGVTSPEDLWHLV
ASGTDAVGGFPTDRGWDLDALRDAGVDARGHSVSQRGGFLDGVADFDAAFFGVSPREAVS
MDPQQRLLLETSWEAVERAGIDPRSLRGSRTGVFVGTNGQDYAYLLVRSLADATGDIGTG
IAASATSGRLSYTLGLEGPAVTVDTACSSSLVALHAAAHALRAGECGLALAGGVNVMSAP
GSLMEFSRAGGLAGDGRCKAFADEADGTGWSEGVGVLLLERLSDARRNGHPVLAVLRGSA
VNQDGASNGFTAPNGPSQQRVIQQALAAAGLTAADVDAVEGHGTGTPLGDPIEAQALLAT
YGQGRPEDRPLLLGSVKSNIGHAQAAAGVAGVIKMIMAMRHGVVPRSLHADHPSRHVDWD
SGAVRLLSEAVEWPETGRPRRAGVSSFGISGTNAHVVIEQAGPAAEPESPAEPETVPTVV
PWPVHARSEASLDAQIEAVTALTDATPLDIGHSLATGRSLFEHRAVLLSGLDGVPAEAAR
GRATERSLAVLFSGQGAQRAEMGRELYARFPVFAKALDEITALLDPRLDRPLREVMFARR
RTPEAALLDTTGYTQPALFAVEVALHRLVESWGVVPDFVAGHSIGEIAAAHVAGVFSLED
ACTLVAARARLMQELPAGGAMVAVQATEAEAAPRLTEGVALAAVNGPDSVTLAGEEAQVL
ALAAEFAAEGRKTQRLAVSHAFHSPLMEPMLAEFRRVAESLTYHEPVLPVVSNVTGALAD
DRLLCDPEYWVDHVRSTVRFADGVRALAGAGADTFVELGPDGILTALAQQCLDGPDVVAV
PVLRKDRAEERALLTALARLHVAGVDIDWAACFEGTGARRTELPTYRWQHERYWPVLMAA
AGDVSAAGLVSAEHPLLGAAVSLAGSDGVLFTGRLSAQTHPWLLDHTVGGMVAFPGTGFL
ELAVRAGDQVGCDRVEDLTLAKPLILTENSAAVVQVHVGAADADGARRVTVYSQAVDDPE
QRWTEHASGLLTRGERVTGFDSTVWPPRGAVAADLEGFYARTEYGPVFQGLRAVWTRDDE
AFVEVALPPQVDDAEYYGMHPALLDAAVQSVGFAGLGDGKKLVPFSWSGVSLHAGGASVV
RVRVARVGEDTVSIAAVDVEGAPVLSADSLILRAPSALRAPTLHSSEQDGLLRLEWVAAP
EGGAAPVRAVTLGTDRAWPGPLASLADAAAVTPAPDLVLVPLEGVEDDTPTAVHAATART
LALIQEWLEPATSAAGRLVFVTRGAVATGTDTGVSDLAAAAVHGLVRSAEAENPGRFALL
DLDAGTAAPSGELLAQLPPLLAAGDTQFAVRDEAVLVARLARLSTGASLLPVPGLPWRLD
TTVPGSIDGLSLVPAPEALDEPEGRAVRVEVRAAGLNFRDVLNALGMYPGEAGLLGSEAV
GLVTAVGPDVTGIAVGDRVTGMIPGGLADTVLVDERYVTRVPEEWSDEDAASVPLVFLTA
LYAFRDLASVQAGERVLIHAGAGGVGMAAIQLARHMGAEVFATASEPKWETLRGLGLDDA
HIASSRDLGFEEKFREVTGGAGMDVVLNALAGDFVDASLRITAPGGRFLEMGKTDIRDPQ
TTGEVRYRAFDLGEAAPERIGEMLTELLGLFAEGALQPLPVRAWDVRRAREAFRFMSQAR
HVGKIVLTMPPRWNPEGTVLVTGGTGGLGREVARHLVSARGVRRLLLVSRRGPAAEGVDA
FREELAGLGAHVDVVACDVADRAAVAGLLGSVPVGHPLTAVVHTAGVLDDGVVTGLSPER
LSGVLRPKVDAAWHLHELTRDMGLAGFVMFSSVSGVMGSAGQANYAAANVFMDALAQYRR
AEGLAGLSLAWGAWEQTSGMTGTLTEADMQRVTASGAAPLTVEQGLALLDAATGSDEPLV
VPIGAPSGDQRVLGLVPPLLRNLVRGTRRSAATAAGGASTAADLARRLLALPAEDRVRHA
VELVRTEAAAVLGHASARAVEPGREFRELGFDSLTAVELRNRLTTVTGLRLTATLVFDYP
TPHGLAEHLVAELLDEHGETGTPVVAADVADDPVVIVGMACRMPGGIETPDDLWRMLADG
EDRITGFPTDRGWDLDALFGGGGDNRGVSATRRGGFLHDVGGFDAGFFGISPREAMAMDP
QQRLLLETSWEALERSGIDPTGLRSSATGIFVGTTGQDYANLVMTSREDVEGHASTGLAT
SVISGRVSYALGLEGPALTVDTACSSSLVALHLAAQSLRSGESSLALAGGVTVLSTPMNF
FGFTRQGGLAGDGLCKAFADAADGTGWSEGVGMLVLERLSDARRNGHDVLAVVRGSAINQ
DGASNGLTAPNGPSQQRVIRQALATAGLSADEVDAVEAHGTGTTLGDPIEAQALLATYGQ
DRPEDRPLLLGSIKSNIGHTQAAAGVAGVIKMVLAMRHGALPRSLHIDQPSTHVDWEAGA
VRLLTETTGWPETGRPWRAGVSSFGLSGTNAHVILEQPEPETADTESPEPQAEPEALARV
VPWPVSARTEEALPGQLARITALDAAPLDIGHSLATGRASFDHRVVLLAGADGEDEPVEV
ARGRAVERRLAVLFSGQGSQRAGMGRELYGRFPVFTKALDEVLALLDPKLDRPLREVLFA
EEGSETAALLDTTGYTQPALFAVEVALYRLVESFGVVPEFVAGHSVGEISAAHIAGVLSL
EDACTLVAARARLMQELPAGGAMVAVQATEAETAGRLTGGLSLAAVNGPDSVVIAGPDHE
VDALASEFAAEGRKVQRLAVSHAFHSALMEPMLDAFHDVAKGLGYGEPRIPVVSDVTGTL
AEPGQLSRPEYWVEHVRSTVRFADAVHALDQAGANAYLEIGPGGVLTVLAQQTLDAAGTA
SDSVTAPALRKDRAEEPALLTALATLHVTGVPVDWAGCFEGTGARRVELPTYAFQHERYW
PRPSAHGGDVTGAGLSPAAHPLLGAATGLAASEGVLFTGRLSLTTHPWLADHTVGGGMVL
FPATGFLELAVRAADEVGCDRVEEFTLATPLLLPADTAVVVQVWAGAPDESGARTVSLYS
RSADVPDATWTQHATGVLTSGAVTLPAVAEIWPPKGAVAVGLEDFYDRTEYGPVFRTIRA
VWKRGDEAFVEAALPPQADDAEYYGMHPALLDAAVQSVGFAGLDDEHQLLPFLWAGVSLH
AGGASVVRFRVARTGEDSVSIAAVDVEGAPVLSAESLVLRVPAGDHAPAARRTELDSLLR
LEWTAGPETGDAPAARHTTAGALGTGGAAATLAPLTGEEDLVLVEVPAPAEGADVPAATH
ERAAQALALAQEWLADERFADTRLVFVTRGAVCARPGERVDDLPAAAVWGLVRAAQSENP
TRFALLDLDDTTPVETALPQLLGPLSGGDAQFVVREGAVLVGRLDRAVTAPSLLPPADGP
WRLDSPSRGSLDALTLRPCPEELAEPQERQVRVEVRAAGLNFRDVLNALGMYPGEAGLLG
AEAAGFVTAVGPEVTGLSVGDRVMGMVPGGLATETLIDERFLTRVPEEWSDEDAASVPLV
FLTAYYALTELAGLSAGERVLIHAGAGGVGMAAIQLARHMGAEVFATASEPKWETLRGLG
LDDAHIASSRDLGFEEKFREETGGAGMDVVLNALAGDFVDASLRITASGGRFLEMGKTDI
RDPHAVGDVRYRAFDLGEAGPDRTGEMLSELLGLFAEGALRPLPVRAWDVRRAREAFRFM
SQARHVGKIVLTMPPRWNPEGTVLVTGGTGGLGREVARHLVSARGVRRLLLVSRRGPAAE
GVDAFREELAGLGAHVDVVACDVADRAAVAGLLASVPVGHPLTAVVHTAGVLDDGVVTGL
SPERLSGVLRPKVDAAWHLHELTRDMGLAGFVMFSSVSGVMGSAGQGNYAAANVFMDALA
QYRRAEGLAGLSLAWGAWEQTSGMTGTLTDAGVRRMSASAAPALTVEQGLALLDAAVVSD
EPHLVPLGASGSTRMPGEVPPLLRNLVRGTRRAAATAVGGAGTADELTRRLLDLREDERL
RFAVNLIRAEAASVLGHSSAQAIDAERDFHDLGFDSLTAVELRNRLTGATGLRLPATLVF
DHPTPGVLAEHLIAALLDEQRATGATAPTPVAAALAEDPVVIVGMACRMPGGVSSPEELW
QLVLDGQEGISAFPTDRGWDLDTLQRGGESGHGRSATSEGGFLYDVADFDAGFFGISPRE
ALAMDPQQRLLLETTWEAFERAGITPTEVRGSRTGVFVGTSGQDYTTLVMNSRQDAEGHA
PTGLATSVISGRLSYTFGLEGPAVTIDTACSSSLVALHWAAHALRSGEADLALAGGVTVM
STAMGYAGFTRQGGLATDGRCKAFADAADGTGWSEGVGMLVVERLSDARRNGHPVLAVLR
GSAVNQDGASNGLTAPNGPSQQRVIRQALASAGLSTDEVDAVEAHGTGTTLGDPIEAQAL
LATYGQDRPGDRPLLLGSIKSNIGHAQAAAGVAGVIKTVMAIRHGVLPRSLHIDRPSTHV
DWTEGDVRLLTETTEWPETGRPRRAAVSSFGISGTNAHTIIEQAPEIVEATPAAASAPAP
AAVPWPVSAKSPEALDAQLARIATVTGATPLDIGHSLATGRASFEYRAVLLAGTGAEDEP
VEVARGRAVERRLAVLFPGQGSQRAGMGRELYERYPVFAKALDEITALLDPELDRPLREV
LFAEEGSETAALLDTTGYTQPALFAVEVALHRLLESQGVSPEYVAGHSVGEIAAAHVAGV
FSLEDACRLVAARARLMQELPAGGAMAAVQATEAEIAPRLTEGLSLAAVNGPDSVVVSGP
ESEVTALAAEFVAEGRKTQRLQVSHAFHSALTEPMLDAFREVARSLAYAEPRLPVVSNVT
GALAAPGQLTDPEYWVRHVRETVRFADGVRALAEAGADAYLEAGPGGVLTALARQTLGTD
SEAVTAPALRKDRAEEPALLTALATLHVTGVPVDWAACFEGTGARRVDLPTYAFQRVRHW
PDTRRPGTGGGSSDPLDGAFWTAVEGEDLTRLATDLAVDTEALGAVLPALSTWRRRRRDQ
AMVDSNRHHETWKPLSLPPGAPAPAGTWLAVVPAAYGEDPWTAAVLDAVGTDVVRLTVDT
VERHALADRLRALSADGAALAGVVSLLALADTPEAAVSGDPAGAPAAPTAVLFQALLDAG
VDAPLWCLTRGAVAVAGSEAVTAPAQAAVWGLGRVAALEHPAVWGGLVDLPSAWDERAAR
RFAAVLAGHDGEDQVAVRSSAAFARRLVPAPAAEPGDGWQPRGTVLVTGGTGGRGAHVAR
WLAGAGAAHLVLLGRRGPDAPGADALRAELEAAGARVTLVACDAADRDALAAVLDGIPAD
TPLSAVVHAAAVVDDGVLDDLTPERFAAPHHARTAPALHLDELTRGLDLDVFALCSSVAG
TVGTAGRANLAAATAVLDALARSRRSEGLPATSMAWGAWIGDADETGGDDAPAAPRAGAG
HPAVHPDLALAALRQAVTRPEAAPVLFDPRQPQVLDGLIGMRGNALLRDLPDARQALADA
ETTRDRARTAASGLAERLRGLPADERTDSVTELVRTHAAAVLGHPGPEAVAADRNFRDLG
FDSLTAIELPNRIALATGLRLPATTVYDYPTAQALAEHLLAELLGEQDTPGSGRATPAAL
AEDPVVIVGMACRLPGGVRSPQDLWAMVSEGRDGIEAFPEDRGWDLATLTTGGADGRGRS
ATLRGGFLSGAADFDAAFFGISPREALAMDPQQRLLLETTWEAFERSGIDADQLRGSRTG
VFVGTNGQDYSTLVMNSREDLEGHAGTGLAASVVSGRLAYTFGLEGPAVTVDTACSSSLV
ALHWAMQALRAGECDLAVAGGITMMSTPSAFSGFTLQNGLAVDGRCKAYADAADGTGWSE
GVGLIVVERLSDARRNGHEVLAVVRGSAINQDGASNGLTAPNGPSQQRVIRQALAGGGLT
PSDIDAVEGHGTGTPLGDPIEAQALLATYGQDRPADRPLLLGSIKSNIGHTQAAAGVAGI
IKTVMAMRHGVLPRTLHVDRPSTHVDWESGAIRLLTEESAWPDSGRPWRAGISSFGISGT
NAHTIIEQAPAPEPAEPGAALLPGPTPTVVPWPVSAKSEEALDGQIAAVTALDGAAPLDV
GHSLATGRARFDHRAVLLARPGTTPWEAARGRAAVRSLALLFSGQGSQRAGMGRELYDRF
PVFAEALDAVLARLDTGLTPSLREVLFAEEGSGTAALLDTTGYTQPALFAVEVALYRLVE
SWGVRPGHVAGHSVGEIAAAHVAGVFSLEDACRLVAARARLMQELPSGGAMVAVRATEAE
VVPRLTEGLSLAAVNGPDSVVIAGTEDEALALAEAFAAEGRKTQRLPVSHAFHSPLMEPM
LDAFRQVAESLEYAEPRIPVVSDVTGALAEPGQLTRAAYWVEHVRATVRFADGVRALAGA
GANAFLEIGPGGVLTALAQSVLEADDRDEAVVLPALRKDRDEETALLTAVAGLHVSGVRV
DWSAWFTGTGARRTELPTYAFQRERYWPRPAALTGDISTAGLISAEHPLLGAAVPLADSE
GVLFTSQISMQVHPWLLDHRVGGTVIMPGTGYLEMAIRAADQVGCARVEELVLAAPMVLD
EKHPVSVQVVVGAPDDTGTRPVTFYSRPSDAVDAPWSRHADGFLAVQERTDSFEAPVWPP
ADAVSVEFDGDYSRTGYGPSFQGLRQVWLRGEEAFVEVALPEEVAGDAQYFGMHPALLDA
VQHANGYLGVGSEENPLLPFAWNGVSLHARGATTLRVRITRLGDESVRLTAVDAEGVPVL
CAESLVLRAPTVPSAPVATGGQEPVFRLDWTAAPAVKPTEGLTAATLGEDVFGVGTALAS
LTELTGPDADPSAAPDFVLVPLAGAGDAAGAGDPDAHGADVPAAVHALTTRTLDLLQQWQ
AAERLGHSRLVFVTTGAVAAHDTETVRDLAAGAAWGLVRSAQSENPDRFVLLDLDGADAP
DTLRALLPDLPGLLGSGDAQFAVREGTALVGRLERLTTAPGLLAPTGTPWRLDTTGKGSL
DNLVLAPCPEVLQPLGAHEVRIDVEAAGLNFRDVLNALGMYPGESGPMGTEAAGVVTAVG
EAVTGLAPGDRVLGTVPGGFGPVVVADQHYVTQVPEGWTMRDAASVPLVFLTALYAFRDL
ASVQAGERVLIHAGAGGVGMAAIQLARHVGAEVFATASEPKWETLRSLGLDDAHIASSRD
LGFEEKFREVTGGAGMDVVLNALAGDFVDASLRITAPGGRFLEMGKTDIRDPQTTGEVRY
QAFDLGEAGPERNKALLGELLDLFAEGALRPLPVRTWDVRRAREAFRFMSQAKHTGKIVL
TMPPRWNPEGTVLITGGTGALGGHLARRFARAGMRHLLLTSRRGADAPGAAELAAELREL
GAEVTVAACDTADREATAALLDAVPAAHPLTAVVHTAGILDDGVIASLTPERLAAVLRPK
VDAAWHLHELTRDLDLAAFLPFSSVAGVMGSPGQGNYAAANSFLDALTRHRRHLGLAGTS
LAWGPWAHDGGMTSTLSDTDMRRMQSGGLPPLAVDQGLELFDIARGSDESFLVLVGLAAG
AMRGAAPEDLPPLFRSMVRSGRRTAASTDAAGASAALGAKLAGLGAAERVRYVTDLVREQ
AARVLGHASPKSVDVSQEFRELGVDSLTALELRNHLATATGLRLPATLVFDYPTPTALAE
HFVAELAGDDAVPQGPSLLAELDRFETLLSAGDPDEITRAGLALRLGQMLDQVRGNAPEQ
AGSSLDDDFESASTDEVFAFIDNELGRLGDL
selected fasta
>polyketide synthase [FscE]
ATGACCACGCCCAGCGAAAAAGTTGTCGAAGCTCTCCGGGCCTCGCTCAAGGAGACCGAA
CGCCTGCGCCGGCAGAACCGCGACCTCGCGGCCGCCGCCTCGGAGCCCGTCGCCGTCGTC
GCGATGAGCTGCCGCTACCCCGGGGGAGTCACCTCCCCCGAGGACCTGTGGCACCTCGTC
GCCTCCGGCACCGACGCCGTCGGCGGCTTCCCCACCGACCGGGGCTGGGACCTGGACGCG
CTGCGGGACGCCGGGGTCGACGCCCGTGGCCACTCCGTCAGCCAGCGGGGCGGCTTCCTC
GACGGGGTCGCCGACTTCGACGCCGCCTTCTTCGGCGTCTCCCCGCGCGAAGCCGTCTCC
ATGGACCCCCAGCAGCGGCTGCTGCTGGAGACCTCCTGGGAGGCCGTGGAGCGCGCCGGC
ATCGACCCGCGCAGCCTGCGAGGCAGCCGCACCGGCGTCTTCGTCGGCACCAACGGCCAG
GACTACGCGTACCTCCTGGTGCGCTCCCTCGCCGACGCGACCGGCGACATCGGCACCGGC
ATCGCCGCCAGCGCCACCTCCGGCCGCCTCTCCTACACCCTGGGCCTGGAGGGGCCGGCG
GTCACCGTCGACACCGCCTGCTCCTCCTCCCTCGTCGCCCTCCACGCCGCCGCCCACGCC
CTGCGCGCGGGGGAGTGCGGCCTCGCCCTCGCCGGCGGCGTCAACGTCATGTCCGCCCCC
GGCTCGCTGATGGAGTTCAGCCGCGCCGGCGGCCTGGCCGGTGACGGCCGCTGCAAGGCG
TTCGCCGACGAGGCCGACGGCACCGGCTGGTCGGAGGGGGTCGGTGTCCTCCTCCTGGAG
CGGCTCTCCGACGCCCGCCGCAACGGCCACCCGGTCCTCGCCGTGCTGCGCGGCTCCGCC
GTCAACCAGGACGGCGCCTCCAACGGCTTCACCGCCCCCAACGGCCCCTCCCAGCAGCGC
GTCATCCAGCAGGCGCTGGCCGCCGCCGGACTCACCGCCGCCGACGTCGACGCGGTCGAG
GGCCACGGGACCGGCACCCCGCTCGGCGACCCCATCGAGGCCCAGGCCCTGCTCGCCACC
TACGGCCAGGGCCGCCCCGAGGACCGGCCGCTGCTGCTCGGCTCCGTCAAGTCGAACATC
GGCCACGCGCAGGCCGCCGCGGGAGTCGCCGGCGTCATCAAGATGATCATGGCGATGCGG
CACGGCGTCGTCCCGCGCTCCCTCCACGCCGACCACCCCTCGCGCCACGTCGACTGGGAC
TCCGGGGCCGTCCGGCTGCTCTCCGAGGCCGTCGAGTGGCCCGAGACCGGCCGCCCGCGC
CGCGCCGGCGTCTCCTCCTTCGGCATCAGCGGCACCAACGCCCACGTCGTGATCGAGCAG
GCCGGACCCGCCGCCGAGCCGGAGTCCCCGGCGGAGCCCGAGACCGTCCCGACCGTCGTG
CCGTGGCCCGTGCACGCCCGCTCCGAGGCGTCCCTGGACGCGCAGATCGAGGCCGTCACC
GCTCTCACCGACGCCACGCCCCTCGACATCGGCCACTCCCTGGCCACCGGGCGCTCCCTC
TTCGAGCACCGCGCCGTCCTGCTCTCCGGCCTCGACGGCGTCCCCGCCGAGGCGGCCCGC
GGCCGCGCCACCGAACGCTCCCTCGCCGTCCTGTTCTCCGGCCAGGGCGCCCAGCGCGCC
GAGATGGGCCGCGAACTGTACGCCCGCTTCCCGGTGTTCGCGAAGGCACTGGACGAGATC
ACCGCCCTGCTCGACCCGCGCCTGGACCGCCCGCTGCGGGAGGTGATGTTCGCCCGGCGC
CGCACCCCCGAGGCGGCCCTCCTCGACACCACCGGCTACACCCAGCCCGCGCTCTTCGCC
GTGGAGGTCGCCCTCCACCGCCTCGTCGAGTCCTGGGGCGTGGTCCCGGACTTCGTGGCC
GGGCACTCCATCGGCGAGATCGCCGCCGCCCACGTCGCCGGTGTGTTCTCGCTGGAGGAC
GCCTGCACGCTGGTCGCCGCCCGCGCCCGCCTCATGCAGGAACTGCCCGCGGGCGGCGCC
ATGGTCGCCGTCCAGGCCACCGAGGCCGAGGCCGCCCCGCGCCTGACCGAGGGCGTCGCC
CTCGCCGCCGTCAACGGCCCCGACTCCGTCACCCTGGCGGGCGAGGAGGCCCAGGTCCTC
GCGCTGGCCGCCGAGTTCGCCGCCGAGGGCCGCAAGACGCAGCGCCTGGCGGTCAGCCAC
GCCTTCCACTCGCCGCTGATGGAGCCGATGCTCGCGGAGTTCCGCCGCGTCGCCGAGAGC
CTCACCTACCACGAGCCGGTCCTGCCGGTCGTCTCCAACGTCACCGGCGCCCTCGCCGAC
GACCGCCTGCTGTGCGACCCCGAGTACTGGGTGGACCACGTCCGCTCCACGGTCCGCTTC
GCCGACGGCGTCCGCGCCCTGGCCGGCGCCGGCGCCGACACCTTCGTCGAACTGGGCCCC
GACGGCATCCTCACCGCCCTCGCCCAGCAGTGCCTCGACGGGCCCGACGTCGTCGCCGTC
CCCGTCCTGCGCAAGGACCGCGCCGAGGAGCGCGCCCTGCTCACCGCGCTGGCCCGGCTC
CACGTCGCCGGCGTCGACATCGACTGGGCCGCCTGCTTCGAGGGCACCGGTGCCCGCCGC
ACCGAACTGCCCACCTACCGCTGGCAGCACGAGCGCTACTGGCCCGTCCTGATGGCCGCC
GCCGGGGACGTCAGCGCCGCGGGCCTGGTCTCCGCCGAACACCCGCTGCTCGGCGCCGCC
GTGTCGCTGGCCGGCAGCGACGGGGTCCTCTTCACCGGACGCCTCTCCGCGCAGACCCAC
CCGTGGCTGCTGGACCACACGGTCGGCGGGATGGTGGCCTTCCCCGGCACCGGCTTCCTC
GAACTCGCCGTCCGCGCCGGTGACCAGGTCGGCTGCGACCGCGTCGAGGACCTCACCCTC
GCCAAGCCCCTCATCCTCACCGAGAACTCGGCGGCCGTCGTCCAGGTCCACGTCGGCGCG
GCCGACGCCGACGGCGCCCGCCGCGTCACCGTCTACTCCCAGGCCGTCGACGACCCCGAG
CAGCGCTGGACCGAGCACGCCTCCGGTCTGCTGACCCGTGGCGAGCGCGTCACCGGCTTC
GACTCCACCGTCTGGCCGCCCCGCGGCGCCGTCGCCGCCGACCTGGAGGGCTTCTACGCG
CGCACCGAGTACGGCCCGGTCTTCCAGGGACTGCGCGCCGTCTGGACCCGCGACGACGAG
GCCTTCGTCGAGGTCGCGCTGCCGCCCCAGGTGGACGACGCCGAGTACTACGGGATGCAC
CCCGCGCTGCTCGACGCCGCCGTCCAGTCCGTCGGCTTCGCCGGTCTCGGTGACGGCAAG
AAGCTCGTACCGTTCTCCTGGTCCGGCGTCTCGCTGCACGCGGGCGGCGCCTCCGTGGTG
CGGGTGCGGGTCGCCCGGGTCGGTGAGGACACGGTGTCCATCGCCGCCGTGGACGTCGAG
GGCGCCCCGGTGCTCTCCGCCGACTCCCTCATCCTGCGCGCCCCTTCGGCGCTGCGCGCC
CCCACCCTGCACAGCAGTGAGCAGGACGGGCTCCTGCGCCTGGAGTGGGTGGCCGCACCC
GAGGGCGGCGCCGCCCCCGTGCGCGCCGTCACCCTCGGTACCGACCGCGCCTGGCCCGGC
CCTCTCGCCTCCCTCGCCGACGCCGCCGCCGTCACGCCCGCCCCCGACCTGGTCCTCGTC
CCGCTGGAGGGCGTCGAGGACGACACCCCCACGGCCGTCCACGCGGCCACCGCGCGCACC
CTGGCACTGATCCAGGAGTGGCTGGAGCCGGCCACGTCCGCCGCCGGACGTCTCGTGTTC
GTCACCCGGGGCGCCGTCGCCACCGGGACCGACACCGGCGTGAGCGATCTCGCCGCCGCC
GCGGTGCACGGACTCGTCCGCAGCGCCGAGGCCGAGAACCCCGGCCGCTTCGCCCTCCTC
GACCTCGACGCGGGCACCGCCGCGCCCTCCGGTGAACTCCTGGCGCAGCTTCCTCCCCTC
CTGGCGGCCGGCGACACGCAGTTCGCCGTACGCGACGAGGCCGTCCTGGTGGCCCGCCTG
GCCCGGCTGTCCACCGGCGCGAGCCTACTGCCGGTCCCGGGGCTGCCGTGGCGCCTGGAC
ACCACCGTCCCCGGCAGCATCGACGGCCTCTCCCTCGTCCCCGCACCCGAGGCACTGGAC
GAGCCGGAGGGCCGCGCCGTCCGGGTCGAGGTGCGGGCTGCGGGGCTGAACTTCCGTGAC
GTGCTGAACGCGCTCGGCATGTACCCCGGCGAGGCCGGACTGCTCGGCTCGGAGGCGGTC
GGCCTCGTCACGGCCGTCGGCCCGGACGTCACCGGGATCGCCGTCGGCGACCGCGTGACC
GGCATGATCCCCGGCGGCCTCGCCGACACCGTCCTCGTCGACGAGCGGTACGTGACCCGC
GTGCCCGAGGAGTGGAGCGACGAGGACGCGGCCTCGGTGCCGCTGGTCTTCCTCACCGCC
CTGTACGCCTTCCGTGACCTGGCCTCGGTCCAGGCGGGGGAGCGGGTGCTGATCCACGCC
GGTGCGGGTGGTGTCGGTATGGCGGCGATCCAGCTGGCACGGCACATGGGTGCCGAGGTC
TTCGCGACGGCGAGTGAGCCCAAGTGGGAGACGCTGCGGGGTCTGGGGCTGGACGACGCT
CACATTGCGTCCTCGCGTGACCTGGGCTTCGAGGAGAAGTTCCGGGAGGTGACCGGTGGC
GCGGGGATGGACGTGGTCCTGAACGCGCTCGCGGGTGACTTTGTGGACGCGTCGTTGCGG
ATCACGGCTCCCGGTGGCCGGTTCCTGGAGATGGGCAAGACCGACATCCGCGACCCGCAG
ACCACGGGCGAGGTCCGCTACCGGGCCTTCGACCTCGGCGAAGCAGCCCCCGAGCGTATC
GGCGAGATGCTGACCGAGCTCCTCGGCCTGTTCGCGGAGGGGGCGTTGCAGCCGCTTCCG
GTGCGTGCGTGGGATGTGCGTCGGGCGCGTGAGGCGTTCCGTTTCATGAGTCAGGCGAGG
CATGTGGGCAAGATCGTGCTGACGATGCCGCCGCGCTGGAATCCCGAGGGGACCGTGCTG
GTCACTGGTGGGACGGGTGGTCTGGGGCGTGAGGTGGCGCGTCATCTGGTGTCGGCGCGT
GGGGTGCGGCGTCTGTTGCTGGTGTCGCGGCGTGGTCCGGCGGCGGAGGGTGTGGACGCT
TTCCGTGAGGAGTTGGCCGGGCTGGGTGCCCACGTGGATGTGGTGGCGTGTGATGTGGCG
GACCGTGCTGCCGTGGCGGGGCTGTTGGGGTCGGTGCCGGTGGGGCATCCGTTGACGGCT
GTGGTGCATACGGCGGGTGTGCTGGACGACGGTGTGGTGACGGGGTTGTCGCCGGAGCGG
TTGTCGGGGGTGTTGCGTCCGAAGGTGGACGCTGCGTGGCATCTGCACGAGTTGACGCGG
GACATGGGTCTCGCAGGGTTCGTGATGTTCTCGTCGGTGTCCGGTGTGATGGGCAGTGCG
GGGCAGGCGAACTATGCCGCTGCCAATGTGTTCATGGATGCGTTGGCGCAGTACCGCCGG
GCCGAGGGTCTGGCCGGGCTCTCCCTGGCCTGGGGTGCCTGGGAACAGACCAGCGGCATG
ACCGGCACCCTCACCGAGGCCGACATGCAGCGCGTCACCGCCTCCGGGGCCGCCCCGCTC
ACCGTCGAGCAGGGGCTAGCCCTCCTCGACGCCGCCACCGGCTCCGACGAGCCCCTGGTC
GTACCGATCGGCGCCCCGTCGGGCGACCAGCGCGTCCTCGGCCTGGTCCCGCCGCTGCTG
CGCAACCTCGTCCGCGGCACGCGTCGCTCCGCGGCCACGGCCGCCGGCGGCGCGAGCACC
GCGGCCGACCTCGCCCGCCGCCTCCTGGCGCTGCCCGCCGAGGACCGGGTCCGTCACGCC
GTCGAACTGGTCCGCACCGAGGCCGCCGCCGTACTGGGCCACGCCTCGGCCCGGGCCGTG
GAACCCGGGCGCGAGTTCCGCGAGCTGGGCTTCGACTCCCTGACCGCCGTCGAACTGCGC
AACCGCCTCACCACCGTCACCGGCCTGCGCCTCACCGCCACCCTCGTCTTCGACTACCCC
ACCCCCCACGGCCTCGCCGAACACCTGGTCGCCGAACTCCTCGACGAACACGGCGAGACC
GGCACGCCGGTGGTGGCCGCCGATGTCGCCGACGACCCCGTCGTCATCGTCGGCATGGCC
TGCCGGATGCCCGGCGGCATCGAGACCCCCGACGACCTGTGGCGCATGCTCGCCGACGGC
GAGGACCGCATCACCGGCTTCCCCACCGACCGCGGCTGGGACCTGGACGCCCTCTTCGGC
GGTGGCGGCGACAACCGCGGCGTCAGCGCCACGCGACGCGGCGGCTTCCTGCACGACGTG
GGCGGGTTCGACGCGGGGTTCTTCGGCATCTCCCCGCGTGAGGCGATGGCGATGGACCCG
CAGCAGCGCCTGCTGCTGGAGACCTCCTGGGAGGCCCTGGAGCGGTCCGGCATCGACCCG
ACGGGCCTGCGCTCCAGCGCCACCGGCATCTTCGTCGGCACCACCGGCCAGGACTACGCC
AACCTCGTCATGACCTCCCGCGAGGACGTCGAGGGACACGCCAGTACGGGCCTCGCCACC
AGTGTCATCTCCGGCCGCGTCTCCTACGCGCTCGGACTGGAGGGCCCCGCCCTCACCGTC
GACACCGCCTGCTCCTCCTCCCTCGTCGCGCTCCATCTCGCCGCCCAGTCCCTGCGCAGC
GGGGAGAGCTCTCTCGCCCTCGCGGGCGGGGTGACCGTGCTGTCGACGCCCATGAACTTC
TTCGGGTTCACCCGTCAGGGCGGGCTGGCCGGCGACGGCCTGTGCAAGGCGTTCGCCGAC
GCCGCCGACGGGACCGGCTGGTCCGAGGGCGTGGGCATGCTCGTCCTGGAGCGCCTCTCC
GACGCCCGCCGCAACGGCCACGACGTCCTCGCCGTCGTGCGCGGCTCGGCCATCAACCAG
GACGGTGCCTCCAACGGCCTGACCGCGCCCAACGGCCCGTCCCAGCAGCGGGTCATCCGC
CAGGCGCTGGCGACGGCCGGGCTCTCCGCCGACGAGGTCGACGCCGTGGAGGCACACGGC
ACCGGTACCACCCTGGGTGACCCGATCGAGGCCCAGGCGCTGCTGGCGACGTACGGGCAG
GACCGGCCCGAGGACCGGCCGCTGCTGCTCGGCTCCATCAAGTCGAACATCGGCCACACC
CAGGCCGCCGCCGGCGTCGCGGGCGTGATCAAGATGGTGCTCGCCATGCGCCACGGCGCC
CTGCCGCGGTCCCTCCACATCGACCAGCCCTCCACCCACGTCGACTGGGAGGCCGGAGCG
GTCCGGCTCCTCACCGAGACGACCGGCTGGCCCGAGACCGGCCGCCCCTGGCGCGCCGGA
GTCTCCTCCTTCGGGCTCAGCGGCACCAACGCCCACGTGATCCTCGAACAGCCGGAGCCG
GAGACCGCCGACACGGAGTCCCCCGAGCCCCAGGCGGAGCCCGAGGCGCTCGCGCGGGTC
GTGCCGTGGCCCGTCTCCGCCCGTACCGAGGAGGCACTGCCCGGCCAGCTCGCCCGGATC
ACCGCACTCGACGCCGCACCCCTGGACATCGGTCACTCCCTGGCCACCGGCCGCGCCTCC
TTCGACCACCGGGTGGTCCTGCTGGCGGGCGCCGACGGTGAGGACGAGCCGGTGGAGGTG
GCGCGGGGCCGCGCCGTCGAGCGCAGGCTCGCGGTGCTGTTCTCCGGCCAGGGTTCGCAG
CGCGCCGGGATGGGCCGGGAACTGTACGGCCGTTTCCCGGTGTTCACGAAGGCGCTGGAC
GAAGTCCTGGCCCTGCTCGACCCGAAGCTGGACCGTCCGCTGCGCGAGGTGCTCTTCGCG
GAGGAGGGCTCCGAGACGGCCGCTCTCCTGGACACCACCGGCTACACGCAGCCCGCGCTC
TTCGCCGTGGAGGTCGCCCTCTACCGCCTGGTCGAGTCCTTCGGGGTCGTCCCGGAGTTC
GTCGCGGGCCACTCCGTCGGCGAGATCTCCGCCGCCCACATCGCGGGCGTCCTCTCCCTG
GAGGACGCGTGCACGCTGGTCGCCGCCCGCGCCCGCCTGATGCAGGAACTGCCCGCCGGC
GGCGCCATGGTGGCCGTCCAGGCGACCGAGGCGGAGACCGCAGGCCGACTGACCGGGGGC
CTGTCCCTGGCTGCGGTCAACGGCCCGGACTCCGTGGTGATCGCCGGTCCGGACCACGAG
GTCGACGCGCTGGCGTCGGAGTTCGCCGCCGAAGGACGCAAGGTCCAGCGCCTGGCGGTC
AGCCACGCCTTCCACTCGGCGCTCATGGAGCCGATGCTCGACGCCTTCCACGACGTGGCC
AAGGGCCTGGGGTACGGCGAACCGCGCATCCCTGTCGTCTCCGACGTGACCGGCACCCTC
GCCGAGCCCGGGCAGCTCAGCAGGCCCGAGTACTGGGTCGAGCACGTCCGCTCTACCGTC
CGCTTCGCCGACGCCGTCCACGCCCTCGACCAGGCCGGCGCCAACGCCTATCTGGAGATC
GGCCCCGGCGGCGTCCTCACCGTCCTCGCCCAGCAGACCCTCGACGCCGCCGGCACCGCG
AGCGACAGCGTGACCGCGCCCGCGCTGCGCAAGGACCGGGCCGAGGAGCCCGCCCTGCTC
ACCGCGCTCGCCACGCTCCACGTCACCGGCGTCCCCGTCGACTGGGCCGGCTGCTTCGAG
GGCACCGGCGCCCGCCGCGTCGAGCTGCCCACCTACGCCTTCCAGCACGAGCGGTACTGG
CCGCGCCCCTCCGCACACGGCGGGGACGTCACCGGCGCCGGTCTGAGCCCCGCCGCGCAC
CCGCTGCTGGGCGCCGCCACCGGCCTCGCCGCCTCCGAAGGCGTCCTCTTCACCGGACGC
CTCTCCCTCACCACGCACCCCTGGCTCGCCGACCACACCGTCGGCGGGGGCATGGTGCTC
TTCCCCGCCACCGGCTTCCTGGAACTGGCCGTACGCGCCGCCGACGAGGTCGGCTGCGAC
CGCGTCGAGGAATTCACCCTCGCCACCCCGCTGCTGCTGCCCGCGGACACCGCCGTGGTC
GTCCAGGTCTGGGCCGGCGCCCCCGACGAGAGCGGCGCCCGCACGGTCAGCCTGTACTCC
CGGTCCGCCGACGTTCCGGACGCCACCTGGACACAGCACGCGACCGGCGTCCTGACCAGC
GGCGCCGTCACCCTCCCCGCCGTCGCCGAGATATGGCCCCCCAAGGGCGCGGTCGCCGTC
GGCCTGGAGGACTTCTACGACCGCACCGAGTACGGCCCGGTCTTCCGCACCATCCGCGCC
GTCTGGAAGCGCGGCGACGAGGCGTTCGTCGAGGCGGCCCTGCCCCCGCAGGCCGACGAC
GCCGAGTACTACGGGATGCACCCCGCGCTGCTCGACGCCGCCGTCCAGTCCGTCGGCTTC
GCCGGGCTCGACGACGAGCACCAGCTGCTCCCGTTCCTGTGGGCCGGAGTCTCCCTGCAC
GCCGGCGGCGCCTCCGTGGTCCGCTTCCGCGTCGCCCGGACCGGCGAGGACTCCGTCTCC
ATCGCCGCCGTGGACGTCGAGGGCGCCCCGGTGCTCTCCGCCGAGTCGCTGGTGCTGCGT
GTTCCCGCCGGGGACCACGCCCCGGCCGCCCGCCGCACCGAACTCGACTCGCTGCTCCGC
CTGGAGTGGACCGCCGGCCCCGAGACCGGCGACGCCCCCGCCGCCCGTCACACGACCGCC
GGTGCCCTCGGCACCGGCGGGGCCGCGGCCACCCTCGCCCCGCTGACCGGCGAGGAGGAC
CTCGTCCTGGTCGAGGTCCCCGCACCGGCCGAGGGTGCCGACGTGCCCGCCGCCACCCAC
GAGCGCGCCGCACAGGCCCTCGCCCTGGCGCAGGAGTGGCTGGCCGACGAACGGTTCGCC
GACACCCGCCTCGTCTTCGTCACCCGGGGCGCGGTCTGTGCCCGCCCCGGCGAGCGGGTC
GACGACCTCCCCGCCGCCGCCGTCTGGGGCCTCGTCCGCGCCGCCCAGTCGGAGAACCCC
ACCCGGTTCGCCCTCCTCGACCTGGACGACACCACCCCCGTCGAGACCGCTCTGCCGCAA
CTCCTCGGTCCGCTCTCGGGCGGAGACGCCCAGTTCGTCGTCCGCGAGGGCGCCGTCCTG
GTCGGCCGTCTCGACCGGGCCGTGACCGCCCCGTCCCTCCTGCCGCCCGCCGACGGCCCC
TGGCGCCTGGACTCCCCGTCACGCGGCAGCCTGGACGCGCTCACCCTGCGCCCCTGCCCC
GAGGAGCTGGCGGAGCCTCAGGAGCGCCAGGTCCGGGTCGAGGTACGAGCCGCCGGCCTG
AACTTCCGTGACGTGCTGAACGCGCTCGGCATGTACCCCGGCGAGGCCGGACTGCTCGGC
GCGGAAGCGGCCGGGTTCGTCACCGCCGTGGGCCCCGAGGTCACCGGGCTCTCCGTCGGC
GACCGCGTCATGGGCATGGTCCCCGGCGGCCTCGCCACGGAGACCCTGATCGACGAACGC
TTCCTCACCCGCGTACCCGAGGAGTGGAGCGACGAGGACGCCGCCTCGGTGCCCCTGGTC
TTCCTCACCGCCTACTACGCGCTCACCGAACTCGCCGGCCTGTCGGCGGGGGAGCGGGTG
CTGATCCACGCCGGTGCGGGTGGCGTCGGTATGGCGGCGATCCAGCTCGCGCGGCACATG
GGTGCCGAGGTCTTCGCGACGGCGAGTGAGCCCAAGTGGGAGACGCTGCGGGGTCTGGGG
CTGGACGACGCTCACATCGCGTCCTCGCGTGACCTGGGCTTCGAGGAGAAGTTCCGGGAG
GAGACTGGTGGCGCGGGCATGGACGTGGTCCTGAACGCGCTCGCCGGTGACTTCGTGGAC
GCGTCGTTGCGGATCACGGCTTCCGGCGGCCGGTTCCTGGAGATGGGCAAGACCGACATC
CGCGACCCGCACGCGGTCGGTGACGTGCGGTACCGCGCCTTCGACCTCGGCGAGGCGGGA
CCGGACCGGACCGGCGAGATGCTGAGCGAACTCCTCGGCCTGTTCGCGGAGGGGGCGTTG
CGCCCGTTGCCGGTGCGTGCGTGGGATGTGCGTCGGGCGCGTGAGGCGTTCCGTTTCATG
AGCCAGGCGAGGCATGTGGGCAAGATCGTGCTGACGATGCCGCCGCGCTGGAACCCCGAG
GGCACGGTCCTGGTCACTGGTGGGACGGGTGGTCTGGGGCGTGAGGTGGCGCGTCATCTG
GTGTCGGCGCGTGGGGTGCGGCGTCTGCTGCTGGTGTCGCGGCGTGGTCCGGCGGCGGAG
GGTGTGGACGCTTTCCGTGAGGAGTTGGCCGGGCTGGGTGCCCACGTGGACGTGGTGGCG
TGTGATGTGGCGGACCGTGCTGCCGTGGCGGGGCTGTTGGCGTCGGTGCCGGTGGGGCAT
CCGTTGACGGCTGTGGTGCATACGGCGGGTGTGCTGGACGACGGTGTGGTGACGGGGTTG
TCGCCGGAGCGGTTGTCGGGGGTGTTGCGTCCGAAGGTGGACGCTGCGTGGCACCTGCAC
GAGTTGACGCGGGACATGGGTCTCGCAGGGTTCGTGATGTTCTCGTCCGTGTCCGGTGTG
ATGGGCAGTGCGGGGCAGGGCAACTATGCCGCCGCCAATGTGTTCATGGACGCGTTGGCG
CAGTACCGCCGGGCCGAGGGTCTGGCCGGGCTCTCCCTGGCCTGGGGGGCCTGGGAACAG
ACCAGCGGCATGACCGGCACCCTCACCGACGCGGGCGTGCGGCGCATGTCGGCGTCGGCG
GCCCCCGCCCTCACCGTCGAGCAGGGGCTCGCCCTCCTCGACGCCGCCGTCGTCTCCGAC
GAGCCGCACCTCGTCCCCCTCGGAGCCTCGGGCTCCACCCGGATGCCCGGGGAGGTGCCG
CCGCTGCTGCGCAACCTGGTCCGCGGCACCCGGCGCGCCGCCGCGACCGCCGTCGGCGGC
GCGGGTACCGCCGACGAGCTCACCCGGCGCCTCCTCGACCTGCGCGAGGACGAGCGGCTC
CGCTTCGCCGTGAACCTGATCCGGGCCGAGGCCGCCTCGGTCCTCGGCCACTCCTCCGCC
CAGGCCATCGACGCCGAACGCGACTTCCACGACCTGGGCTTCGACTCCCTCACCGCCGTC
GAACTGCGCAACCGCCTCACCGGCGCCACCGGCCTGCGGCTGCCCGCCACCCTCGTCTTC
GACCACCCCACGCCCGGCGTGCTGGCGGAGCACCTGATCGCCGCCCTGCTCGACGAGCAG
CGCGCCACTGGCGCCACCGCCCCGACGCCCGTCGCCGCGGCCCTCGCCGAGGACCCCGTC
GTCATCGTCGGCATGGCCTGCCGGATGCCGGGCGGCGTCAGCTCTCCCGAGGAGCTGTGG
CAGCTCGTCCTCGACGGCCAGGAGGGCATCTCCGCCTTCCCGACCGACCGGGGCTGGGAC
CTCGACACCCTCCAGCGCGGCGGCGAGAGCGGCCACGGCCGCAGCGCCACCTCCGAAGGC
GGATTCCTCTACGACGTCGCCGACTTCGACGCCGGCTTCTTCGGCATCTCCCCGCGCGAG
GCGCTGGCGATGGACCCCCAGCAGCGCCTGCTCCTGGAGACCACCTGGGAGGCGTTCGAG
CGCGCCGGCATCACCCCCACCGAGGTGCGCGGCAGCCGTACCGGTGTTTTCGTCGGCACC
AGTGGCCAGGACTACACCACCCTGGTCATGAACTCCCGTCAGGACGCCGAGGGCCACGCC
CCCACCGGCCTCGCCACCAGTGTCATCTCCGGCCGGCTGTCCTACACCTTCGGACTGGAG
GGCCCGGCGGTCACCATCGACACCGCCTGCTCCTCCTCGCTCGTCGCCCTCCACTGGGCC
GCGCACGCGCTGCGCTCCGGCGAAGCCGACCTGGCGCTCGCCGGCGGCGTCACCGTCATG
TCCACCGCCATGGGGTACGCGGGCTTCACCCGGCAGGGCGGCCTGGCCACCGACGGCCGC
TGCAAGGCGTTCGCGGACGCGGCGGACGGCACCGGCTGGTCCGAGGGCGTGGGCATGCTC
GTCGTCGAGCGCCTCTCCGACGCCCGCCGCAACGGCCACCCGGTCCTCGCGGTACTGCGC
GGCTCCGCCGTCAACCAGGACGGCGCCTCCAACGGCCTGACCGCGCCCAACGGACCCTCG
CAGCAGCGGGTCATCCGTCAGGCCCTCGCGAGCGCCGGGCTCTCGACCGACGAGGTCGAC
GCCGTGGAGGCACACGGCACCGGTACCACCCTGGGTGACCCGATCGAGGCCCAGGCGCTG
CTGGCGACGTATGGGCAGGACCGGCCCGGCGACCGGCCGCTGCTGCTCGGCTCCATCAAG
TCGAACATCGGCCACGCGCAGGCCGCCGCCGGTGTCGCCGGGGTCATCAAGACCGTCATG
GCGATCCGGCACGGTGTCCTGCCCCGCTCGCTCCACATCGACCGGCCCTCCACGCACGTG
GACTGGACCGAGGGCGACGTCCGCCTGCTGACCGAGACCACGGAGTGGCCCGAGACCGGC
CGTCCACGCCGCGCCGCCGTCTCCTCCTTCGGCATCAGCGGCACCAACGCGCACACCATC
ATCGAGCAGGCCCCGGAGATCGTGGAGGCCACGCCGGCCGCCGCGTCCGCCCCGGCTCCG
GCGGCCGTCCCCTGGCCGGTCTCCGCGAAGTCCCCGGAGGCGCTCGACGCACAGCTCGCC
CGGATCGCCACCGTCACCGGCGCCACCCCGCTCGACATCGGCCACTCCCTGGCCACCGGC
CGCGCCTCCTTCGAGTACCGCGCGGTCCTGCTGGCGGGCACCGGTGCCGAGGACGAGCCG
GTGGAGGTGGCGCGGGGCCGTGCCGTGGAGCGCAGGCTCGCGGTGCTGTTCCCGGGCCAG
GGTTCCCAGCGGGCCGGAATGGGCCGTGAACTGTACGAGCGTTACCCGGTGTTCGCGAAG
GCACTCGACGAGATCACCGCCCTGCTCGACCCGGAGCTGGACCGTCCGCTGCGTGAGGTG
CTCTTCGCGGAGGAGGGCTCCGAGACGGCCGCTCTCCTGGACACCACCGGCTACACCCAG
CCCGCGCTCTTCGCCGTGGAGGTGGCCCTGCACCGCCTGCTGGAGTCGCAGGGCGTGTCG
CCGGAGTACGTGGCCGGTCACTCCGTCGGCGAGATCGCCGCCGCGCACGTGGCCGGGGTC
TTCTCCCTGGAGGACGCCTGCCGGCTGGTCGCCGCCCGCGCCCGCCTGATGCAGGAACTG
CCCGCCGGCGGCGCCATGGCGGCCGTGCAGGCCACCGAGGCGGAGATCGCCCCACGGCTG
ACCGAGGGACTCTCCCTCGCCGCGGTCAACGGCCCGGACTCCGTGGTCGTGTCCGGCCCG
GAGAGCGAAGTGACCGCGCTGGCCGCCGAGTTCGTGGCCGAGGGACGCAAGACCCAGCGC
CTGCAGGTCAGCCACGCCTTCCACTCCGCGCTCACGGAGCCGATGCTCGACGCGTTCCGC
GAGGTCGCCCGCTCGCTGGCGTACGCCGAACCGCGTCTCCCCGTCGTCTCCAACGTCACC
GGCGCCCTCGCCGCGCCCGGTCAGCTCACCGACCCCGAGTACTGGGTGCGGCACGTCCGT
GAGACCGTCCGCTTCGCCGACGGCGTCCGCGCCCTCGCCGAGGCGGGAGCCGACGCCTAC
CTGGAGGCCGGCCCCGGCGGCGTCCTCACCGCCCTCGCCCGGCAGACCCTGGGCACCGAC
TCCGAGGCCGTCACCGCGCCCGCGCTGCGCAAGGACCGGGCCGAGGAGCCCGCCCTGCTC
ACCGCGCTCGCCACGCTCCACGTCACCGGCGTCCCCGTCGACTGGGCCGCCTGCTTCGAG
GGCACCGGCGCCCGCCGCGTCGACCTGCCCACCTACGCCTTCCAGCGCGTCCGCCACTGG
CCCGACACCCGGCGCCCCGGTACGGGCGGCGGCTCCTCCGACCCGCTCGACGGCGCCTTC
TGGACCGCCGTCGAGGGCGAGGACCTGACCCGTCTCGCCACCGACCTGGCCGTGGACACC
GAGGCGCTCGGCGCGGTACTCCCGGCCCTCTCCACCTGGCGGCGCCGGCGCCGGGACCAG
GCCATGGTCGACTCCAACCGCCACCACGAGACGTGGAAGCCGCTGTCGCTGCCGCCCGGT
GCGCCCGCCCCGGCCGGAACCTGGCTGGCCGTCGTGCCCGCCGCGTACGGCGAGGACCCC
TGGACCGCCGCCGTCCTCGACGCCGTCGGCACCGACGTCGTCCGCCTCACCGTGGACACC
GTCGAGCGCCACGCGCTCGCCGACCGCCTGCGCGCCCTCTCCGCCGACGGCGCCGCCCTC
GCCGGTGTGGTCTCCCTGCTGGCCCTCGCCGACACGCCGGAGGCAGCCGTCTCCGGCGAC
CCGGCGGGAGCCCCCGCCGCCCCGACCGCCGTCCTGTTCCAGGCCCTGCTCGACGCCGGG
GTCGACGCCCCCCTGTGGTGCCTGACCCGGGGAGCCGTCGCGGTGGCGGGTTCCGAGGCC
GTCACCGCCCCCGCCCAGGCCGCCGTCTGGGGCCTGGGCCGGGTCGCCGCCCTCGAACAC
CCCGCCGTGTGGGGCGGGCTCGTCGACCTGCCCTCCGCGTGGGACGAACGCGCCGCCCGC
CGCTTCGCCGCCGTCCTCGCCGGACATGACGGCGAGGACCAGGTGGCCGTCCGCTCCTCC
GCCGCCTTCGCACGCCGGCTCGTCCCGGCACCGGCCGCGGAGCCCGGCGACGGCTGGCAG
CCCCGCGGAACCGTCCTCGTCACCGGCGGCACCGGCGGACGCGGCGCCCACGTCGCGCGC
TGGCTCGCCGGAGCCGGCGCCGCGCACCTGGTGCTCCTCGGCCGACGCGGTCCCGACGCC
CCCGGCGCCGACGCGCTCCGCGCCGAACTGGAGGCGGCCGGTGCCCGCGTCACCCTCGTC
GCCTGCGACGCCGCCGACCGGGACGCCCTCGCGGCCGTCCTCGACGGCATCCCCGCCGAC
ACCCCGCTCTCCGCCGTCGTCCACGCCGCCGCAGTCGTCGACGACGGAGTCCTCGACGAC
CTGACCCCGGAACGATTCGCCGCTCCGCACCACGCGCGGACCGCGCCCGCCCTCCACCTG
GACGAGCTGACCCGCGGCCTTGACCTCGACGTCTTCGCCCTCTGCTCCTCCGTCGCCGGG
ACCGTCGGCACGGCGGGCCGGGCCAACCTCGCCGCCGCCACCGCCGTACTCGACGCCCTC
GCCCGGAGCCGCCGGAGTGAGGGGCTGCCCGCCACCTCGATGGCCTGGGGCGCCTGGATC
GGGGACGCCGACGAGACCGGAGGGGACGACGCCCCCGCCGCCCCGAGGGCAGGAGCCGGG
CACCCGGCGGTCCACCCGGATCTGGCCCTGGCCGCACTGCGGCAGGCCGTGACCCGGCCC
GAGGCCGCACCCGTCCTGTTCGACCCGCGCCAGCCGCAGGTCCTGGACGGCCTGATCGGC
ATGCGCGGCAACGCGCTCCTGCGCGACCTGCCCGACGCCCGGCAGGCCCTCGCCGACGCC
GAGACCACCCGCGACCGTGCCCGCACGGCCGCCTCCGGACTCGCCGAGCGGCTGCGCGGC
CTCCCCGCCGACGAACGCACCGACAGCGTCACGGAACTGGTGCGCACCCACGCGGCAGCC
GTCCTCGGCCACCCAGGACCGGAGGCCGTCGCCGCCGACCGGAACTTCCGCGACCTGGGC
TTCGACTCGCTCACCGCCATCGAGCTGCCCAACCGGATCGCCCTCGCGACCGGCCTGCGC
CTGCCCGCCACCACCGTCTACGACTACCCGACCGCCCAGGCCCTCGCCGAACACCTCCTC
GCCGAACTGCTGGGCGAGCAGGACACCCCGGGCTCCGGCCGGGCCACCCCGGCGGCACTG
GCCGAGGACCCGGTCGTCATCGTCGGCATGGCCTGCCGCCTGCCCGGCGGGGTCCGCTCC
CCGCAGGACCTGTGGGCCATGGTCAGCGAGGGCCGCGACGGCATCGAGGCATTCCCCGAG
GACCGAGGCTGGGACCTCGCCACCCTGACGACCGGCGGGGCCGACGGCCGGGGCCGCAGC
GCCACGCTGCGCGGCGGATTCCTCTCCGGGGCAGCCGACTTCGACGCGGCCTTCTTCGGC
ATCTCCCCGCGTGAGGCGCTGGCGATGGACCCGCAGCAGCGCCTGCTCCTGGAGACCACC
TGGGAGGCGTTCGAACGGTCCGGCATCGACGCCGACCAACTGCGCGGCAGCCGTACCGGT
GTCTTCGTCGGCACCAACGGCCAGGACTACTCCACGCTCGTCATGAACTCCCGCGAGGAC
CTGGAGGGCCACGCCGGAACGGGCCTCGCCGCCAGCGTCGTCTCGGGCCGGCTGGCCTAC
ACCTTCGGCCTGGAAGGCCCGGCGGTCACCGTCGACACCGCCTGCTCCTCCTCACTGGTC
GCCCTCCACTGGGCGATGCAGGCGCTGCGCGCGGGTGAGTGCGACCTCGCCGTGGCGGGC
GGCATCACCATGATGAGCACCCCGTCCGCCTTCTCCGGCTTCACCCTCCAGAACGGCCTG
GCCGTCGACGGCCGCTGCAAGGCGTACGCGGACGCGGCGGACGGCACCGGCTGGTCGGAG
GGGGTCGGCCTGATCGTCGTCGAGCGGCTCTCCGACGCCCGCCGCAACGGTCACGAGGTC
CTCGCCGTCGTGCGCGGCTCGGCCATCAACCAGGACGGCGCCTCCAACGGCCTCACCGCC
CCCAACGGCCCCTCCCAGCAGCGCGTCATCCGCCAGGCGCTGGCCGGCGGCGGCCTGACC
CCCTCCGACATCGACGCGGTCGAGGGCCACGGCACGGGCACCCCGCTGGGCGACCCGATC
GAGGCCCAGGCCCTGCTGGCGACGTACGGGCAGGACCGGCCCGCGGACCGGCCACTGCTG
CTCGGCTCCATCAAGTCGAACATCGGCCACACCCAGGCCGCCGCCGGCGTCGCCGGCATC
ATCAAGACCGTCATGGCGATGCGCCACGGCGTCCTGCCGCGCACCCTCCACGTCGACCGG
CCCTCGACCCACGTCGACTGGGAGTCCGGGGCGATACGGCTGCTCACGGAGGAGTCGGCC
TGGCCCGACAGCGGCCGGCCCTGGCGGGCGGGCATCTCGTCCTTCGGCATCAGCGGCACC
AACGCGCACACCATCATCGAGCAGGCCCCGGCCCCGGAGCCCGCCGAGCCCGGTGCGGCC
CTCCTGCCGGGGCCCACACCCACCGTCGTCCCGTGGCCGGTGTCGGCCAAGTCCGAGGAG
GCCCTCGACGGGCAGATCGCGGCCGTCACCGCCCTGGACGGCGCGGCCCCGCTCGACGTC
GGCCACTCCCTGGCCACCGGCCGCGCCCGCTTCGACCACCGCGCCGTGCTCCTCGCGCGC
CCCGGCACGACGCCGTGGGAGGCCGCCCGGGGCCGGGCCGCGGTGCGCTCGCTCGCCCTG
CTCTTCTCCGGCCAGGGATCGCAGCGTGCCGGCATGGGCCGCGAACTGTACGACCGTTTC
CCGGTCTTCGCCGAGGCGCTGGACGCCGTCCTCGCCCGGCTGGACACCGGCCTGACCCCC
TCGCTGCGGGAGGTGCTGTTCGCGGAGGAGGGCTCCGGGACGGCGGCACTCCTGGACACG
ACCGGGTACACGCAGCCCGCGCTGTTCGCCGTCGAGGTCGCCCTGTACCGCCTCGTCGAG
TCGTGGGGCGTGCGCCCCGGCCACGTCGCGGGCCACTCGGTCGGCGAGATCGCGGCGGCG
CACGTGGCGGGAGTCTTCTCGCTGGAGGACGCCTGCCGGCTGGTCGCCGCCCGTGCCCGT
CTGATGCAGGAACTGCCCTCGGGCGGGGCGATGGTGGCCGTGCGGGCGACCGAGGCCGAG
GTCGTGCCCCGGCTCACCGAGGGCCTGTCCCTGGCGGCCGTGAACGGCCCCGACTCCGTG
GTGATCGCCGGCACCGAGGACGAAGCCCTCGCCCTGGCGGAGGCGTTCGCGGCCGAGGGC
CGCAAGACGCAGCGCCTGCCGGTCAGCCACGCCTTCCACTCCCCGCTCATGGAGCCGATG
CTCGACGCGTTCCGGCAGGTGGCGGAGAGCCTGGAGTACGCGGAGCCGCGTATCCCGGTG
GTCTCCGACGTCACCGGCGCCCTCGCCGAACCCGGACAGCTCACCCGGGCCGCGTACTGG
GTCGAGCACGTCCGCGCCACCGTCCGCTTCGCCGACGGTGTCCGCGCCCTGGCCGGCGCC
GGCGCCAACGCCTTCCTGGAGATCGGACCCGGCGGTGTCCTGACCGCCCTGGCCCAGAGC
GTCCTCGAAGCCGACGACCGGGACGAGGCGGTCGTCCTCCCGGCCCTGCGCAAGGACCGC
GACGAGGAGACCGCGCTGCTGACCGCGGTCGCCGGGCTCCACGTCAGCGGCGTCCGGGTG
GACTGGTCCGCCTGGTTCACCGGCACCGGCGCCCGCCGCACCGAGCTGCCCACCTACGCC
TTCCAGCGCGAGCGGTACTGGCCGCGCCCGGCCGCCCTCACCGGCGACATCAGCACGGCC
GGCCTCATCTCCGCCGAACACCCCCTGCTCGGCGCGGCCGTCCCGCTCGCCGACTCCGAG
GGCGTCCTGTTCACCAGCCAGATCTCCATGCAGGTCCACCCCTGGCTCCTCGACCACCGT
GTCGGCGGCACCGTCATCATGCCGGGCACCGGCTACCTGGAGATGGCCATCCGCGCAGCC
GACCAGGTCGGCTGCGCCCGCGTCGAGGAACTCGTCCTCGCCGCGCCGATGGTCCTCGAC
GAGAAGCACCCGGTCTCCGTCCAGGTCGTCGTCGGCGCTCCCGACGACACCGGCACCAGG
CCGGTCACCTTCTACTCCCGTCCCTCCGACGCCGTCGACGCGCCGTGGTCCCGGCACGCC
GACGGGTTCCTGGCCGTTCAGGAGCGCACCGACTCCTTCGAAGCCCCCGTCTGGCCCCCG
GCGGACGCGGTCTCCGTGGAGTTCGACGGCGACTACAGCCGTACCGGGTACGGGCCGTCC
TTCCAGGGCCTGCGCCAGGTGTGGCTCCGCGGTGAGGAGGCCTTCGTGGAGGTCGCCCTC
CCCGAGGAGGTCGCCGGGGACGCCCAGTACTTCGGCATGCACCCCGCGCTCCTGGACGCC
GTCCAGCACGCCAACGGCTACCTCGGGGTGGGCAGCGAGGAGAACCCGCTGCTGCCCTTC
GCCTGGAACGGCGTCTCCCTGCACGCCAGGGGCGCCACCACGCTGCGGGTGCGGATCACC
CGGCTCGGGGACGAGTCGGTCCGGCTGACCGCCGTCGACGCGGAGGGCGTCCCGGTGCTC
TGCGCCGAGTCCCTGGTCCTGCGCGCCCCCACGGTGCCCAGCGCCCCGGTCGCCACCGGT
GGCCAGGAGCCGGTCTTCCGCCTGGACTGGACGGCCGCACCCGCGGTCAAGCCCACCGAG
GGCCTGACCGCGGCGACCCTCGGCGAGGACGTCTTCGGCGTGGGCACCGCCCTGGCCTCC
CTCACCGAGCTGACCGGCCCCGACGCCGACCCGTCCGCAGCACCCGACTTCGTCCTCGTC
CCGCTCGCCGGTGCCGGTGACGCGGCGGGGGCCGGGGACCCGGACGCCCACGGCGCCGAC
GTGCCGGCGGCCGTCCACGCGCTGACCACGCGGACGCTCGACCTGCTCCAGCAGTGGCAG
GCCGCCGAGCGGCTCGGCCACTCCCGCCTGGTCTTCGTCACCACGGGAGCGGTCGCCGCC
CACGACACCGAGACCGTCCGCGACCTCGCGGCCGGTGCCGCCTGGGGCCTGGTGCGCTCC
GCCCAGTCCGAGAACCCGGACCGCTTCGTCCTGCTGGACCTCGACGGAGCGGACGCCCCG
GACACCCTGCGCGCGCTCCTGCCCGACCTGCCGGGGCTGCTGGGCAGCGGCGACGCCCAG
TTCGCCGTCCGCGAGGGCACCGCGCTGGTCGGCCGGCTCGAACGGCTCACCACGGCACCC
GGCCTCCTCGCCCCCACCGGCACCCCGTGGCGCCTGGACACCACCGGCAAGGGCAGCCTG
GACAACCTGGTCCTCGCCCCGTGCCCGGAGGTCCTCCAGCCACTCGGCGCCCACGAGGTC
CGCATCGACGTCGAGGCGGCCGGCCTCAACTTCCGCGACGTGCTGAACGCGCTCGGCATG
TACCCGGGCGAGTCCGGCCCCATGGGCACCGAGGCCGCCGGCGTGGTCACCGCCGTCGGC
GAGGCCGTCACCGGCCTCGCCCCCGGCGACCGCGTCCTCGGCACCGTGCCCGGCGGATTC
GGCCCCGTCGTCGTCGCCGACCAGCACTACGTCACCCAGGTCCCCGAAGGCTGGACCATG
CGGGACGCGGCCTCGGTGCCGCTGGTCTTCCTCACCGCCCTGTACGCCTTCCGTGACCTG
GCCTCGGTCCAGGCGGGGGAGCGGGTGCTGATCCACGCCGGTGCGGGTGGTGTCGGTATG
GCGGCGATCCAGCTCGCGCGGCACGTGGGCGCCGAGGTCTTCGCCACGGCGAGCGAGCCC
AAGTGGGAGACGCTGCGGAGTCTGGGGCTCGACGACGCTCACATCGCGTCCTCGCGTGAC
CTGGGCTTCGAGGAGAAGTTCCGGGAGGTCACCGGTGGCGCGGGGATGGACGTGGTCCTG
AACGCGCTCGCCGGTGACTTCGTGGACGCGTCGTTGCGGATCACGGCTCCCGGTGGCCGG
TTCCTGGAGATGGGCAAGACCGACATCCGCGACCCGCAGACCACGGGCGAGGTCCGCTAC
CAGGCCTTCGACCTCGGCGAGGCCGGACCGGAGCGGAACAAGGCCCTCCTCGGCGAACTC
CTCGACCTCTTCGCCGAGGGCGCGCTGCGGCCGCTCCCGGTGCGCACCTGGGACGTCCGG
CGGGCCCGCGAGGCGTTCCGCTTCATGAGCCAGGCCAAGCACACCGGCAAGATCGTGCTG
ACCATGCCGCCCCGCTGGAACCCCGAGGGCACCGTCCTCATCACCGGCGGCACCGGCGCA
CTCGGCGGCCACCTCGCCCGCCGCTTCGCCCGGGCCGGCATGCGCCACCTGCTGCTGACC
AGCCGGCGCGGCGCGGACGCCCCCGGCGCCGCCGAACTCGCCGCCGAGCTGCGGGAACTG
GGCGCCGAGGTCACCGTCGCCGCCTGCGACACCGCCGACCGCGAGGCCACGGCCGCGCTC
CTCGACGCGGTCCCGGCCGCACACCCGCTCACCGCCGTCGTGCACACCGCGGGCATCCTC
GACGACGGGGTGATCGCCTCCCTCACGCCCGAACGCCTCGCCGCCGTCCTGCGGCCCAAG
GTGGACGCCGCCTGGCACCTGCACGAGCTGACCCGCGACCTCGACCTCGCCGCCTTCCTG
CCCTTCTCGTCCGTCGCGGGCGTCATGGGCAGCCCCGGCCAGGGCAACTACGCCGCGGCC
AACTCCTTCCTGGACGCCCTCACCCGGCACCGGCGCCACCTCGGCCTGGCCGGCACCTCG
CTGGCCTGGGGCCCCTGGGCCCACGACGGCGGCATGACCAGCACCCTGTCCGACACGGAC
ATGCGCCGCATGCAGTCCGGCGGACTCCCGCCGCTCGCCGTCGACCAGGGCCTGGAACTG
TTCGACATCGCCCGGGGCTCGGACGAGTCCTTCCTCGTCCTGGTCGGTCTCGCCGCCGGA
GCGATGAGGGGCGCGGCGCCGGAGGACCTGCCCCCGCTGTTCCGCTCCATGGTCCGCAGC
GGCCGCCGTACCGCCGCCTCCACGGACGCGGCCGGCGCTTCGGCCGCGCTCGGCGCCAAG
CTCGCCGGGCTCGGTGCCGCCGAGCGCGTCCGGTACGTCACCGACCTGGTCCGCGAACAG
GCCGCCCGGGTCCTGGGCCACGCCTCACCGAAGTCCGTCGACGTCAGCCAGGAGTTCCGC
GAGCTGGGCGTCGACTCGCTGACGGCGCTGGAACTCCGTAACCACCTGGCGACCGCGACC
GGGCTGCGGCTGCCCGCCACGCTGGTCTTCGACTACCCGACCCCCACCGCGCTCGCCGAA
CACTTCGTCGCCGAGCTGGCCGGTGACGACGCCGTCCCGCAGGGACCGTCGCTCCTCGCC
GAACTCGACCGCTTCGAGACGCTGCTGTCGGCCGGGGACCCGGACGAGATCACCCGCGCG
GGCCTCGCCCTGCGACTGGGCCAGATGCTCGACCAGGTGCGCGGCAACGCCCCCGAGCAG
GCCGGTTCCTCCCTCGACGACGACTTCGAGTCGGCCAGCACCGACGAGGTCTTCGCCTTC
ATCGACAACGAGCTCGGCCGCCTGGGCGACCTCTGA
[17] KS35..410
[17] AT551..866
[17] malonyl-CoA740..744
[17] dh914..1071
[17] er1385..1687
[17] KR1697..1877
[17] ACP1980..2050
[18] KS2072..2448
[18] AT2593..2912
[18] malonyl-CoA2782..2786
[18] DH2960..3118
[18] ER3429..3731
[18] KR3741..3921
[18] ACP4023..4093
[19] KS4118..4494
[19] AT4636..4952
[19] malonyl-CoA4825..4829
[19] kr5263..5442
[19] ACP5550..5620
[20] KS5643..6019
[20] AT6161..6480
[20] malonyl-CoA6350..6354
[20] DH6527..6684
[20] ER7018..7320
[20] KR7330..7509
[20] ACP7613..7683
[17] KS103..1230
[17] AT1651..2598
[17] malonyl-CoA2218..2232
[17] dh2740..3213
[17] er4153..5061
[17] KR5089..5631
[17] ACP5938..6150
[18] KS6214..7344
[18] AT7777..8736
[18] malonyl-CoA8344..8358
[18] DH8878..9354
[18] ER10285..11193
[18] KR11221..11763
[18] ACP12067..12279
[19] KS12352..13482
[19] AT13906..14856
[19] malonyl-CoA14473..14487
[19] kr15787..16326
[19] ACP16648..16860
[20] KS16927..18057
[20] AT18481..19440
[20] malonyl-CoA19048..19062
[20] DH19579..20052
[20] ER21052..21960
[20] KR21988..22527
[20] ACP22837..23049

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [543-675]  G3DSA:3.40.366.10 [740-856]  G3DSA:3.40.366.10 [2585-2717]  G3DSA:3.40.366.10 [2782-2902]  G3DSA:3.40.366.10 [4628-4760]  G3DSA:3.40.366.10 [4825-4942]  G3DSA:3.40.366.10 [6156-6285]  G3DSA:3.40.366.10 [6350-6469]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1697-1864]  1e-61 PF00106 [3741-3908]  4.30000000000003e-62 PF00106 [7330-7496]  8.49999999999995e-66 PF00106
PF00106   adh_short
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [1513-1534]  PS01162 [3557-3578]  PS01162 [7146-7167]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [2008-2023]  PS00012 [4051-4066]  PS00012 [7641-7656]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1973-2088]  7.49999605851445e-27 SSF47336 [4016-4134]  2.800005042611e-28 SSF47336 [5543-5659]  2.90000354677981e-27 SSF47336 [7604-7690]  7.89999609889417e-23 SSF47336
SSF47336   ACP_like
 [1980-2050]  PS50075 [4023-4093]  PS50075 [5550-5620]  PS50075 [7613-7683]  PS50075
PS50075   ACP_DOMAIN
 [1983-2049]  2.1e-10 PF00550 [4026-4092]  1.1e-12 PF00550 [5553-5619]  2.4e-12 PF00550 [7616-7681]  1.4e-12 PF00550
PF00550   PP-binding
 [1981-2053]  7.79999999999999e-86 G3DSA:1.10.1200.10 [4025-4095]  7.79999999999999e-86 G3DSA:1.10.1200.10 [5548-5623]  7.79999999999999e-86 G3DSA:1.10.1200.10 [7613-7687]  7.79999999999999e-86 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [1379-1531]  2.19999900980708e-32 SSF50129 [3436-3575]  1.90000694315261e-33 SSF50129 [7008-7155]  3.80000697093586e-30 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [3568-3659]  2.6e-18 PF00107 [7157-7256]  5.5e-20 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1406-1461]  2.7e-06 PF08240 [3449-3505]  4.20000000000001e-07 PF08240 [7038-7094]  3e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [5263-5440]  5.10000000000004e-56 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-285]  2.70000000000002e-89 PF00109 [2072-2322]  4.09999999999995e-89 PF00109 [4118-4368]  8.60000000000005e-93 PF00109 [5643-5893]  3.10000000000005e-89 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-410]  6.49999999999992e-47 PF02801 [2330-2448]  1e-47 PF02801 [4376-4494]  7.4e-47 PF02801 [5901-6019]  9.09999999999992e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [551-866]  2.09999999999996e-67 PF00698 [2593-2912]  1.5e-67 PF00698 [4636-4952]  7.5e-71 PF00698 [6161-6480]  1.39999999999997e-69 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [547-857]  6.40004254961849e-76 SSF52151 [2589-2881]  5.79999653854781e-71 SSF52151 [4632-4936]  4.10001399699315e-73 SSF52151 [6157-6460]  7.80005155399507e-72 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [677-739]  4.09999599045784e-14 SSF55048 [2719-2781]  7.30000590915208e-15 SSF55048 [4762-4824]  2.39999798157265e-15 SSF55048 [6287-6349]  1.49999977583352e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [34-295]  G3DSA:3.40.47.10 [297-461]  G3DSA:3.40.47.10 [2074-2334]  G3DSA:3.40.47.10 [2335-2500]  G3DSA:3.40.47.10 [4117-4378]  G3DSA:3.40.47.10 [4380-4546]  G3DSA:3.40.47.10 [5642-5904]  G3DSA:3.40.47.10 [5905-6071]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-409]  1.3000049540733e-100 SSF53901 [2064-2446]  3.79997359309398e-100 SSF53901 [4110-4492]  3.49999466863949e-101 SSF53901 [5635-6017]  8.39998014024973e-98 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1521-1624]  2.89999999999999e-63 G3DSA:3.40.50.720 [1697-1884]  G3DSA:3.40.50.720 [3565-3669]  2.89999999999999e-63 G3DSA:3.40.50.720 [3741-3928]  G3DSA:3.40.50.720 [5263-5478]  G3DSA:3.40.50.720 [7154-7254]  2.89999999999999e-63 G3DSA:3.40.50.720 [7330-7515]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [198-214]  PS00606 [2235-2251]  PS00606 [4281-4297]  PS00606 [5806-5822]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [551-847]  SM00827 [2593-2893]  1.90000694315261e-124 SM00827 [4636-4933]  3.20005520639588e-130 SM00827 [6161-6460]  2.1000026783403e-125 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1981-2053]  1.3000049540733e-34 SM00823 [4024-4096]  4.69998262513195e-33 SM00823 [5551-5623]  2.800005042611e-32 SM00823 [7614-7686]  1.60000240695997e-34 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [914-1071]  1.69998802370953e-79 SM00826 [2960-3118]  2.39999798157263e-74 SM00826 [6527-6684]  1.09999184471405e-75 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-463]  SM00825 [2074-2500]  SM00825 [4120-4546]  SM00825 [5645-6071]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1697-1877]  5.00000909915354e-63 SM00822 [3741-3921]  1.3000049540733e-62 SM00822 [5263-5442]  3.1999989904635e-50 SM00822 [7330-7509]  3.10001307370206e-60 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1385-1687]  SM00829 [3429-3731]  SM00829 [7018-7320]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit