close all open/close all

CDS information : FR008_00200


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction136,148 / 107,496 / - [in whole cluster]
136,148 / 107,496 / - [in contig]
Locationcomplement(107496..136148) [in whole cluster]
complement(107496..136148) [in contig]
TypeCDS
Length28,653 bp (9,550 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)FscD
Gene
Gene (GenBank)fscD
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)

close this sectionPKS/NRPS Module

11 malonyl-CoA
12 malonyl-CoA
13 methylmalonyl-CoA
not conserved YASHS(S->T)
14 malonyl-CoA
15 malonyl-CoA
16 malonyl-CoA
KS39..404
AT563..884
DH933..1096
KR1410..1590
ACP1692..1762
KS1786..2159
AT2316..2644
KR2972..3151
ACP3244..3322
KS3342..3715
AT3873..4190
KR4499..4679
ACP4780..4850
KS4872..5248
AT5410..5738
KR6049..6228
ACP6329..6399
KS6426..6796
AT6938..7258
kr7559..7728
ACP7836..7906
KS7931..8301
AT8466..8786
KR9099..9278
ACP9383..9453

close this sectionSequence

selected fasta
>polyketide synthase [FscD]
MGCVDMDKEQKLRDYLKRASADLKRSRQRVTELEAAATEPIAIVGMSCRYPGGVSSPEDL
WKMLVAGEDGITGMPEDRGWEAALGEGPADFAGGFLHDAPAFDPDFFGISPREALSMDPQ
QRLLLETGWEAFERAGIDPAGVRGSRTGMFVGAMPQDYRVGPDDDVQGFQLTGNATSILS
GRLSYFFGAVGPAVTVDTACSSSLVALHLAAQSLRAGECSLALAAGVTVMASPTTFVEFA
RQGGLAADGRCRSFADAANGTGWSEGVGVLVLERLSEARRNGHRVLAVVRGSAVNQDGAS
NGLTAPNGPSQQRVIESALVNARLTAADVDAVEAHGTGTVLGDPVEAQALLATYGQGREA
DSPLLLGSVKSNISHTQAAAGVAGVIKMVMAMRHGLLPRTLHVDQPSTHVDWSEGSVRLL
TEPAPWPARENAPRRAGISSFGLSGTNAHTIIEEAPQEPAADGEAAPAVDAGALPWLLSG
RTPEALRAQAARLLDHLAARPTPSALDVSHALATTRSALEHRAAFTTADRDTAVAVLTAL
AAGADAPGLTTHQLRGRTKLAVLFSGQGSQRPGMGRDLHARFPVFARALDEILEHLDAGL
DRPLKPLILAEEGSEEAALLDRTEYAQPALFALEVALYRLVESWGVTPDHLTGHSVGEIA
AAHVAGVFTLADACTLVTARGRLMQALDEGGAMVSLEATEDEVAPLVAEHAGQVSVAAVN
GPAAVVVSGAEDAVESIAARVAALGRRTRRLRVSHAFHSPLMDPMLEEFRAVVAGLSPQA
PTVPVVSNLTGAPATVEQLTSAGYWTDHVRHAVRFADGVSWLAGHGTGLFLELGPDATLA
ALTRTVLDAAGHERAAVLPALRKDRPEAATLTETATGLHLRGVPVRWDRWFEGTGAGHTD
LPTYAFQHRRFWPKGVTGLTGDMRSAGLGAAHHPLLAAAVTLANSDGLLLTGRLSVRTHP
WLADHTVRGTVLLPGTAFLELAVRAGDEVGCDRVEELTLAAPLALPEDGGVQVQVWIGSP
DETGRRALTLYSRPDGDDDRPWTQHAAGTLTNGAHHGEEFDAAVWPPAGAESVGLDGFYE
GLAESGFAYGPAFRGLRAVWRRGEETFAEVALDAGPAGDASSFGLHPALLDAALHATALA
PLGEDARGGLPFAWQDVTLHAAGATEARVRITPAGDDAVTLTVADTTGAPVASVGSLVLR
SAPDARRAAAGVLERDALFHLDWTRLHGADAPETPGTVGLLGPDPLRLGAALTAAGVTVG
PLTEAAGPDTPALVLVPVGGGDPEAVPAEVHASTARVLGHIQRWLAEDTRAGARLVFVTR
GAVAVGEGPLTDPAAAAVWGLVRSAQAEHPHRFGLLDLDPVAGTDPAALVAALAAEEPQT
ALRGDTVFAARLARVRPDGETTAAAWNPEGTVVVTGGTGGLGAALARHLVTERGVRHLVL
AGRRGPDAPGAAGLAADLGALGAEVTLAACDVADPEAVDRLFAAVPAAHPVTAVVHTAGT
LDDGLVESLTEERLAAVLRPKADAVWHLHRATRDLDLAAFVVFSSLAGTTGAPGQANYAA
GNAFLDAVARLRRDAGLPGLSLGWGPWVPVDGGMTGELSERDLERMSRSGTPPLTVEQGL
ALFDATLALPRAAVLPVRLDLAALRGRGEVPPLLRGLVRTRARRTVRTGSEAALGLAQRL
ARLDEQARTEAVVDLVRDRTAAVLGHASAADIDPERPFQELGFDSLTAVELRNGLAAATG
LRTSATVIFDYPTVAALAGHLLAELTDAPEAEAPAPAPRTSATADDPIVIVGMSCRYPGG
VGSPDDLWRLVTEGTDAIGGLPVNRGWDLDSLYHPDPDHPGTSYTRYGGFLHDAGEFDAG
FFGMSPREALATDSQQRLLLEASWTAVEHAGIDPVGLRGSRTGVFAGVMYSDYSATLADE
RFEGHQGSGTAPSIASGRVSYALGLEGPAVTVDTACSSSLVAMHWAMQALRSGECSLALA
GGVTVMSTPTSLIEFSRQRGLSPDGRCKAFSDEADGVGWSEGVGMLVLERLSDARRNGHR
VLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALDTAGLTTADVDAVEAHGTGTALGDP
IEAQALLATYGQDRPGDRPLLLGSVKSNIGHTQAAAGVAGIIKMVMAMRHGELPRTLHAG
SPSRHVDWETGDVRILQEPEAWPETGRPRRAGVSSFGISGTNAHVVLEQGESAPAGSTGT
PPAEATVLPWTLSGRTRPALRAQAARLLAHLDARPDEAPADLTHSLATTRPAFEQRAVVV
GTADDARRALAALAADRPDPALVLGETGGTGRTALLFTGQGSQRPGTGRELYERHPVFAE
ALDEVVARLDPLLVDAPAGTPHGSLKDVMFAEEGTPGAAALYETGWTQPALFALETALYR
LVRSWGVRPGVLLGHSVGGIGAAHAAGVLSLDDACALVAARARLMQALPEGGAMWSLQAS
EDEVLPLLQGQEDVAALAAVNGPSAVVVSGEEEATAAIAAHFAGLGRATRRLRVSHAFHS
PRMDAVLDAFREVAEGLTYHEPTVPVACDLTGRLAEGDHLRTADYWVRHVRSTVRFADAV
RAAHEAGATTYLELGPGGSLCAAAQDTLGDDSEADAVPTLRTGRPEDESVLTALARLHVR
GVRVDWGAVHPAGAGTVELPTYAFQHETYWPDTTAPTVRRTGDGSGDPADAELWTAVERG
DATGLAGLLGLRDEEHASLYTLLPSLSSWRRARQERAVLDAARYRIAWQPAGTESAPVLD
GTWLAVTTEDDGAADTVLAALRGHGAVVERLVLDASHLDRDLLTTTLRDAVENATAEGAA
GVRGILSLLPLADAARPEATGTDAPAGGLPAGFALGVVLAQALGDAAVTAPLWTVTRGAV
STGPGDPLTHPARAAAWGLGRVAALERPEQWSGLVDLPEVLDAPATQRLVSLLATRDGED
QLAVRAGGTLARRVVRHPGDALPREDEFTASGTVLVTGGTGGLGAEAARWLARSGAAHLV
LTGRRGPDAPGAAELRAELEELGARVTLTACDSADRDALAAVLAAVPEDAPLTGVVHAAG
VGQAAPLADTPLDQVAAAMAAKTLGAAHLDALLDGHDLDFLVLVSSVAGVWGSAGQSAYA
AANAYLDALAENRRSRGLAATSVAWGPWAEVGMASAHRTVSENLERAGLRLLNPATAMTE
LRRAVVRGETTVTVADVDWEQYHPVFTAARSSRLFDTVDTVAALAAPGSTGTVSGLAERL
GGLTEQEQERLLVDLVRAEAAVVLGHTSAEGVPVKKAFRDAGFDSLTAVELRKRLAHLTG
LALPSTLVFDYPNPLALARHLRAELLGTVETAPVATGPAVTDEPIAIIGMSCRFPGGARS
ADAFWQLVADNTDAISEFPVNRGWDGDALYDPDPDRPGTTYSTQGGFLHDAGEFDAGFFG
ISPREAVSMDPQQRLLLETTWEAFEHAGIDPAAVHSTPTGTFIGSTYQDYGVSMDDGSAG
HAVTGSSPSVLSGRLAYSFGLEGPAVTVDTACSSSLVALHLACQSLRNGETTLALAGGAT
VMTNPMPFIAFSRQRALARDGRCKAFSESADGMTLAEGVGILVLERLSDARRNGHEVLAV
VRGSAINQDGASNGLTAPNGPSQVRVIRQALAASGLTTDDIDAVEAHGTGTALGDPIEAQ
ALHATYGRDRDPENPLLLGSVKSNIGHTQSAAGVAGIIKMVMAMRHGTLPRTLHATEPSS
HIDWSGGTVRLVTENTGWARDDRPLRAAVSSFGISGTNAHAILEQAAPAEEPAPAAGPAL
PTGGTLPWILSAAAPSALREQAANLAAHVTSGAAPHPADVGHTLITARSVLEHRAVALGA
DAGELTDALAAFGAGESTGQVVHGTADTDGRTVFVFPGQGSQWAGMGAELLDTSPVFAER
LHACAAALAPYTDWDLVDVVRQADGAPTLDRVDVVQPATWAVMVSLAELWRAHGVTPDAV
IGHSQGEIAAAVVSGALTLDDGARVVALRSQAIRRVLAGAGGMMSVQVSAAEAEQYLTPH
AGAVSVAAVNGPRSVVLAGTPEALDALQAEFAARDLRARRIAVDYASHTAQVERIEAELL
DLLAPVAPRAARVPFHSTVTGATLDTTGMDAAYWYRNLRQTVRFEDGVRALLDTEHTLFV
EISPHPVLTMAVQATAEEAGRPAAAVGTLRREQGGTARFLTSLAEQWVRGGRADWNAVYA
DTGARRTPLPTYAFQREHLWAVSARPQGSGDGDPADAEFWAEVEQEDAESLASRLELDRE
ALAPLLPALSTWRRGRRDRSTVGSWRYRATWKPLGALPSATLDGTWLLVTAEGTDPEYAA
AVAEQLTAHGARTVPLALTGADADRAALTERLRDLPEPAAVVSLLADDESTGAAHPVLTT
GLALSVTLTQALGDAGIEAPLWALTRGAVSTGRADRLTRPAQALVQGFGWTAALEHPDRW
GGTVDLPETLDRRAGERLAAVLAGTTGEDQLAVRASGVLARRVSPAPAPTGTGRWSPRGT
VLVTGGTGTLGPHLARWLADQGARDLVLTSRRGADAPGAAELAAELGERGCRVTVAACDV
TDREAVAALLDGLTAEGRTVRSVFHTAAVIELQSIEETSLDAFAKVVHAKTAGAAHLDEL
LDDDQLDAFVLYSSTAGMWGSGRHAAYVAANAHVNALAEHRCARGAHGTAVSWGIWADDM
KLGRVDPGQIRRSGLEFMDPRLALAGLRQVLDGDQGAVAVADVDWDRYHPVFTSSRPTEL
FENVPEVRRLTEQQEARAGEAGEFIHRLRSLPAGEQDRLLLELVRSEAATVLGHASPEVL
SERRAFRDIGFDSLTAVDLRNRLASVTGLTLPSTLVFDYPDPLTLVGHLRGLAGGPAAGP
DGPVRTTAATDDEPIAVVAMSCRYPGGVTSPEALWELIAAGADAITGFPADRGWDADALY
DPDPDRPGTTYSTQGGFLHDVADFDAGFFGISPREALAMDPQQRLLLETGWEAIERAGID
PATLRGSMTGTFIGASYQDYTAGGAGSEGAEDHLITGTISSVMSGRLAYTFGLEGPAVTL
DTACSSSLVALHLACQSLRNGESTLALAGGVSVMATPQAFTGFSRQRAMAPDGRCKAYAE
GADGMSLAEGVGLVLVERLSDARRNGHPVLAVIRGSAVNQDGASNGLTAPNGPSQARVIR
QALANARLTPGEVDVVEGHGTGTALGDPIEAQALLATYGQDRPGDRPLLLGSVKSNIGHT
QMASGIAGVMKMVMAMRHGTVPRTLHVDTPSSHVDWGSGAIDLATETVPWPETGRPHRAA
VSSFGLSGTNVHTIVEQAPEEPATEPSASPAPAGDPATLPPGVPVVLSARTPAALREQAE
RLAGHLAGRPDVPLVDLAHSLATTRGVLEHRAAVLTGDRDGLLRALTALREGAPDASLLT
GAPARGGLAFLFTGQGSQRPAMGRDLYERHPVFGEALDAVLTRFDQELDRPLREVLFAEE
GTAEAALLDDTAYTQPALFALEVALYRLVESWGVRPDQVAGHSVGEIAAAHVAGVFSLDD
ACALVAARGRLMAALPAGGAMVAVEASEEEVLPLLEGGEDRISLAAVNGPRAVVIAGDEE
PVAAVAARLAEDGRRTRALKVSHAFHSPRMDAMLDDFARVARGLTYETPLVPVVSTVTGA
PATPEELRSPEYWVGQVRATVRFADAVRTLARQGVTSCLELGPDGTLSAAARDVLDADPA
DATGARPVTVVPALRRDRDEVPFLTAALARLHVHGTAVDWTGAFEGTGARRVDLPTYAFQ
RSRYWPDTTFTPATAAGPADTGADAAFWSAVERADLPTLGADLGLDDDTLSALVPALSSW
RRRRTAQAAADGRRHRIVWKPLDGAPTGRPEGTWLVLRPTGTAAPETAALLDTLGLDTAE
VTVDLAAPDRAALADTLRRLPRPEDGFTGVLALPALDTAATADDVAGTGAVAPTAAALNA
LDDAGITAPLWIVTRQAVSTGRADRLARPGQAGVWGLGRVAALENPGRRLALVDLPEQFD
TRVARRLAHLLAVPGTENQLAVRASATYARRIAHHPAPQEPARPFAPEGTVLITGGTGAL
GAHVARLLAGRGTPHLLLTSRRGADAPGAAELAAELRELGAEVTLAACDTADREALAALL
AEVPADRPLTTVVHAAGVLDDGLLDTLTPERFAAVLDAKARSAAHLHELTRDLGLTDFVL
FSSTAGTLGAAGQANYAAANAYLDALAEHRREQGLPATSVAWGPWSGTGMAGEGTGVEDR
VRRGGFTPMSPEDALAALDAAVGHRDTALLVADIDWQRYATVFAPHRALVGDLPEVRATV
GAATAHGDTEPALRRQVAALTGPARERYVLDFLRAQVAAVLGHPDPDAVEADQAFTDLGF
DSLTTVELRNTLGATTGLRLPATLVYDHPTARDLAAHLLTEILGDLPEPAAGGNAAGEAP
RATETDPVVVVGMGCRFPGGVESPEELWQLLGEGRDAVSGFPADRGWDLDSLARGGSATL
EGGFLQGAGLFDASFFGISPREALAMDPQQRLLLETSWEALERAGIDPTGLRSSATGVFV
GTNGQDYATVLRRGTTDVRGHAATGTTASVMSGRLSYTLGLEGPAVTVDTACSSALVALH
MAAGALRSGECTLALAGGVSVMASPDAFVEFTAQGGLAGDGRCKAFADAADGTAWGEGAG
VLVLERLSDARRHGHPVLAVLRGSAVNQDGASNGLTAPNGRAQQRVIRQALADAHLTPAE
VDAVEAHGTGTTLGDPIEAHALIAAYGEGRDPEQPLLLGTVKSNLGHTQAAAGAAGVIKT
VLALGHGELPRTLHVDAPSSHVDWSDGTVELLREHRAWPETGRARRAGVSAFGVSGTNAH
VILEQPEPATAETPEPVTEPSVVPWLVSARSEDALAAQTARLTAFTQARPEVPALDTAYS
LATGRGAFAHRAVHLVTAGGEPLETVRDRAWERRLALLFSGQGSQRAGMGRELYERFPVF
AEALDSVVARLDTGLERSLREVLFAEEGSEAAALLEATGYTQPALFAVEVALFRLVESWG
VAPEFVAGHSVGEIAAAHVAGVFSLDDACALVAARARLMQELPTGGAMVAVRATEAEVVP
RLTEGLSLAAVNGPDSVVIAGEQEEVLALAAEFAGEGHKTQPLPVSHAFHSALMEPMLAE
FRRVAESLEYAEPRVPVVSNVTGALAQPGQLTDPEYWVRHVRETVRFADGVRALAEAGAD
AYLEIGPDGVLTGMAARVLDTAADGSGGVSVPALRKDRPEEHSLLTALARLHTAGVAVDW
TAWFTGTGARRTDLPTYAFQRELYWPEPATGPHTATAQDPADAAFWAAVEREDLESLSAT
LDLDDAVLSNVLPALSTWRRGLSERTLLDGWRYRVTWQPVPLGNTADDGTGRPWLVLTLA
GHDDAWTQALAATFGEHTVHLAVPADEDGTAALLDGAADGTAYAGVLSLLAGTATDGTAR
PDTLLRLLAAAGIDAPLWCVTRDAVSVGRSDPAADPDRAALWGLGRVLALDEPERWGGLV
DVDHVADARTVDRLRAVLTVARTDGPAEDQVALRASGAFGRRLSRAAAPAPDITWHPAGT
VLVTGRAEGFGGHVARWLAAHGATGVLLAGPAGPEDAATTALRAEVEALGATLTVVRHPD
PADAAPLTEALAAQADDRPLTAVLHTGDTGEETPGVTGARAAYEALTTAVGDRDLDAFVV
FGSISAVWGVGGQGAGAAAGVCLDALVQRHRAHGTNAVSVSWGAWQGAGPDGLAAHLRAN
GLPAMEPARALDALAPAIGEAAANPAAPASVTVADVAWDRFAPAFTRTRAGLLLTGVPEA
REALSTTGGDGADAGTASALRERLRQSDPSERPRTLLDTVLTEIASVLGHTGAAAVPAEN
AFNDLGFDSLTAVDLRNRLTTATGLTLPATLVFDYPTPAALAAHLLTELLGEDTGPGTGA
PVARAAADADDPVVIVGMSCRYPGDVRSPEDLWELVGAGTDAIGGFPTDRGWDLEKLLHG
DEDGRGRSVTREGGFLYDVADFDPAFFGISPREALVIDPQQRIVLQAAWEALERAGIDPA
VLRGGDTGVFVGGGSGDYRPAIGQSGHVETAQSASLLSGRLSYTLGLEGPSVSVDTACSS
SLTALHLAAQAIRSGECSLALAGGVTVMSTPVGFVEFGEMGALSPDGRCKPFSDAADGTA
WSEGVGMLVVERLSEARRRGHEVLAVLRGSAINQDGASNGLTAPNGPSQQRVIRKALAAA
GLTAREVDAVEAHGTGTTLGDPIEAQALLATYGQDRPEGQPLLLGSVKSNIGHSQAASGV
AGIIKMVLAMRHGTLPRTLHAEKPSRHVAWDPDAVHLLTEAADWPETGRPRRAAVSSFGA
SGTNAHVILEQAPTGPAAPERDTEPATHATDAARLLPLPLSAATADSLTEQAARLRDRLT
AGAAQPPATADLALSLGTTRSAFEHRAVLAVAGRDDLLDALTALAEDRAHPAVLRGRAAP
GGRTAFLFPGQGSQRPGAGRALYARFPVFATALDEVLAHFDQELERPLRDVMFADEGTPE
AALLDRTGWTQPALFALGVALYRLVESWGVRPDLLAGHSVGELAAAHVAGVLSLPDACRV
VSARARLMEALPAGGAMLAVRATEDEIAPYLTDQICLAAVNGPESVVVSGDEKAVTALAE
ALAEQGRKTRRLRVSHAFHSLHMDAMLQDFERVTRSVSYAPPTLPLVSNLTGDAATDAQV
CDPGYWVRHVREAVRFGDGVRTLAGRGATRYLELGPDGILCGLAQETLDTLADENRPAPT
AVPALRTGRDEEQALITAVARLHAAGQGLDWAALLDGTGARRVDLPTYPFRRLRFWPDEA
PAAATGTTADAGDAAFWAAVQDEQFDSLAGELGVDGDALLRVLPALRDWRRKHGDQTTVD
GWRQRIAWRPLNRATAGTPAGTWLAVVPADHADHPWTSAVLAALGAGAQVLEVSGKDRAG
LAAAIRERLDATGPFTGVVSLLAVAGEPGDGTGALPGGVPAGAALTATLVQALGDARTDA
PLWCLTRGAAAVSPAETVAAPLQAAVHGLGRVAALEHPQRWGGTVDLPLAVDARTAERLA
AVLADPEGEDQLAVRPGAVFGRRLAAVRPGTPRDWKPTGTVLITGGTGALGARTARRLAG
AGARRLVLLSRSGPDAPGAGELAADLRALGAEPVITACDTADRKALAAVLAAIPEDAPLT
GVIHTAGVLDDGVVDGLTPERFATVFRAKVASALLLDELTRAHDLEVFALFSSASAAVGN
PGQGTYAAANAVLDALAEQRRAEGLPATSVAYGAWGGEGMADGVRAAALARRTGIRPLDP
DLAVLALRQVVTGSDPVAVVADVDPDRFVRAFTTVRPSSLLAEMPAYAALKKAASAGGEA
ADSGPSLRDRLARLPESRRTQTVLTLVRERAAEVLGLTGTDQVGPDRAFRDLGFDSLGAV
ELRNQLGAVSGLTLSATLVFDHPTPAALAAHILGQLLPAGTPGAPATDGAGEEERAVRAA
LAQVPLDRLRDSGLLDQLLDLAGQDPAGTGTDQEAEPSGAGDAYDASIDAMDVDGLVQAA
LNGNPDEERD
selected fasta
>polyketide synthase [FscD]
ATGGGTTGCGTTGATATGGACAAGGAACAGAAGCTCCGGGACTACCTGAAGCGGGCGAGC
GCCGATCTGAAGCGCTCCCGGCAGCGGGTGACCGAGCTGGAGGCGGCGGCCACCGAGCCC
ATCGCGATCGTCGGCATGAGCTGCCGCTACCCCGGCGGGGTGAGCAGCCCCGAGGACCTG
TGGAAGATGCTGGTCGCCGGCGAGGACGGCATCACCGGCATGCCCGAGGACCGTGGCTGG
GAGGCCGCGCTCGGCGAGGGCCCCGCCGACTTCGCCGGCGGCTTCCTGCACGACGCGCCC
GCCTTCGACCCGGACTTCTTCGGCATCTCGCCCCGCGAGGCGCTGTCCATGGACCCGCAG
CAGCGCCTGCTCCTGGAGACCGGCTGGGAGGCCTTCGAACGGGCCGGTATCGACCCCGCG
GGCGTACGCGGCAGCCGCACCGGCATGTTCGTCGGCGCCATGCCCCAGGACTACCGGGTC
GGCCCCGACGACGACGTCCAGGGCTTCCAGCTCACCGGCAACGCCACCAGCATCCTCTCC
GGGCGGCTCTCCTACTTCTTCGGTGCCGTCGGACCGGCCGTGACCGTCGACACCGCCTGC
TCCTCCTCCCTGGTGGCCCTGCACCTGGCCGCCCAGTCGCTGCGCGCGGGGGAGTGCTCC
CTGGCCCTGGCCGCCGGTGTCACCGTCATGGCCAGCCCCACCACCTTCGTCGAGTTCGCC
CGCCAGGGCGGCCTCGCCGCCGACGGGCGCTGCCGGTCCTTCGCCGACGCCGCCAACGGC
ACCGGCTGGTCCGAGGGTGTCGGCGTCCTCGTCCTGGAGCGGCTCTCCGAGGCCCGCCGC
AACGGCCACCGCGTCCTCGCGGTGGTCCGGGGGTCCGCCGTCAACCAGGACGGTGCCTCC
AACGGCCTGACCGCCCCCAACGGCCCCTCCCAGCAGCGCGTCATCGAGTCCGCCCTGGTC
AACGCCCGGCTCACCGCCGCCGACGTCGACGCCGTCGAGGCACACGGCACCGGCACGGTC
CTCGGCGACCCCGTCGAGGCCCAGGCGCTGCTGGCCACCTACGGCCAGGGCCGCGAGGCC
GACAGCCCGTTGCTGCTCGGCTCGGTCAAGTCCAACATCAGCCACACCCAGGCCGCGGCG
GGTGTCGCGGGCGTCATCAAGATGGTCATGGCGATGCGCCACGGCCTGCTGCCGCGCACC
CTCCACGTCGACCAGCCCTCCACCCACGTCGACTGGAGCGAGGGCTCCGTCCGCCTGCTG
ACGGAGCCCGCCCCCTGGCCGGCCCGCGAGAACGCGCCGCGTCGCGCGGGCATCTCCTCC
TTCGGCCTCTCCGGCACCAACGCGCACACCATCATCGAGGAGGCTCCCCAGGAGCCGGCC
GCCGACGGCGAGGCCGCCCCGGCCGTCGACGCCGGGGCGCTGCCCTGGCTGCTCTCCGGC
CGTACCCCCGAGGCCCTGCGCGCCCAGGCCGCCCGGCTGCTCGACCACCTCGCCGCCCGG
CCCACGCCGTCCGCCCTGGACGTCTCCCACGCGCTCGCCACCACCCGCTCCGCCCTGGAG
CACCGCGCGGCCTTCACCACCGCCGACCGGGACACCGCCGTCGCCGTGCTCACCGCGCTC
GCCGCCGGTGCGGACGCCCCGGGTCTCACCACCCACCAGCTGCGTGGCCGTACCAAGCTC
GCCGTGCTCTTCTCGGGCCAGGGCTCCCAGCGTCCCGGCATGGGCCGCGACCTTCACGCC
CGCTTCCCCGTCTTCGCCCGCGCCCTCGACGAGATCCTGGAGCACCTCGACGCGGGGCTC
GACCGCCCGCTGAAGCCCCTGATCCTCGCCGAGGAGGGCAGCGAGGAGGCCGCGCTCCTC
GACCGCACCGAGTACGCGCAGCCCGCCCTGTTCGCCCTCGAAGTGGCCCTGTACCGGCTC
GTCGAGTCCTGGGGCGTCACCCCCGACCACCTCACCGGCCACTCCGTCGGCGAGATAGCC
GCCGCCCACGTCGCCGGGGTGTTCACCCTCGCCGACGCCTGCACCCTGGTCACCGCCCGT
GGCCGCCTCATGCAGGCGCTGGACGAGGGCGGCGCCATGGTCTCCCTGGAAGCCACCGAG
GACGAGGTCGCGCCGCTCGTCGCCGAACACGCCGGACAGGTCTCCGTCGCCGCCGTCAAC
GGCCCGGCCGCGGTCGTCGTCTCCGGAGCCGAGGACGCCGTCGAGTCCATCGCCGCCCGC
GTCGCGGCCCTCGGGCGCCGCACCCGCAGGCTGCGGGTCTCCCACGCGTTCCACTCACCG
CTCATGGACCCGATGCTGGAGGAGTTCCGCGCGGTCGTCGCCGGACTCTCCCCGCAGGCC
CCCACCGTCCCGGTCGTCTCCAACCTCACCGGCGCCCCCGCCACCGTCGAGCAGCTCACC
TCCGCCGGCTACTGGACCGATCACGTCCGCCACGCCGTGCGCTTCGCCGACGGAGTCTCC
TGGCTCGCCGGACACGGCACGGGGCTCTTCCTCGAACTGGGCCCCGACGCCACGCTCGCC
GCCCTCACCCGGACCGTCCTGGACGCCGCCGGGCACGAGCGCGCCGCCGTGCTGCCCGCG
CTCCGCAAGGACCGCCCCGAGGCCGCCACCCTCACCGAGACCGCCACCGGACTCCACCTG
CGCGGCGTCCCGGTGCGCTGGGACCGCTGGTTCGAGGGGACCGGCGCCGGCCACACCGAC
CTGCCGACCTACGCCTTCCAGCACCGCCGCTTCTGGCCCAAGGGCGTCACGGGGCTCACC
GGCGACATGCGTTCCGCGGGGCTCGGCGCCGCCCACCACCCGCTGCTCGCCGCCGCCGTC
ACCCTCGCCAACTCCGACGGCCTGCTCCTCACCGGCCGTCTCTCGGTGCGCACCCATCCC
TGGCTCGCCGACCACACGGTGCGCGGCACCGTGCTGCTGCCCGGCACCGCCTTCCTCGAA
CTCGCCGTCCGCGCCGGCGACGAGGTCGGCTGCGACCGCGTCGAGGAACTCACCCTCGCC
GCCCCGCTCGCCCTGCCCGAGGACGGCGGCGTCCAGGTCCAGGTCTGGATCGGCAGCCCC
GACGAGACCGGCCGCCGCGCCCTGACCCTGTACTCCCGCCCCGACGGCGACGACGACCGG
CCCTGGACCCAGCACGCCGCCGGCACCCTGACCAACGGCGCCCACCACGGCGAGGAGTTC
GACGCGGCGGTCTGGCCGCCCGCCGGTGCCGAGAGTGTCGGCCTCGACGGCTTCTACGAG
GGGCTGGCCGAGTCCGGCTTCGCCTACGGCCCCGCCTTCCGCGGCCTGCGCGCCGTCTGG
CGCCGGGGCGAGGAGACCTTCGCCGAGGTGGCTCTCGACGCGGGACCCGCGGGCGACGCC
TCTTCGTTCGGCCTGCACCCGGCGCTGCTGGACGCGGCCCTGCACGCCACCGCCCTCGCC
CCGCTCGGCGAGGACGCCCGCGGCGGCCTGCCGTTCGCCTGGCAGGACGTCACCCTCCAC
GCGGCCGGCGCCACCGAGGCCCGGGTCCGCATCACCCCCGCGGGCGACGACGCCGTCACC
CTCACCGTCGCGGACACCACCGGGGCACCCGTCGCCTCGGTCGGCTCCCTCGTGCTGCGC
TCCGCCCCCGACGCGCGCCGGGCCGCCGCCGGCGTGCTGGAGCGCGACGCCCTCTTCCAC
CTCGACTGGACCCGCCTCCACGGCGCCGACGCCCCCGAAACCCCCGGCACCGTCGGTCTG
CTCGGCCCCGACCCCCTCCGGCTCGGCGCCGCCCTCACCGCCGCCGGGGTCACCGTCGGC
CCGCTCACCGAGGCCGCCGGACCCGACACGCCGGCCCTGGTGCTCGTCCCCGTCGGCGGC
GGCGACCCCGAGGCCGTACCCGCCGAGGTCCACGCGAGCACCGCCCGCGTCCTCGGGCAC
ATCCAGCGTTGGCTCGCCGAGGACACCCGGGCCGGGGCGCGCCTGGTGTTCGTCACCCGG
GGCGCCGTCGCCGTCGGCGAAGGGCCGCTCACCGACCCGGCCGCCGCCGCCGTCTGGGGC
CTGGTCCGCTCCGCCCAGGCCGAACACCCCCACCGCTTCGGCCTGCTCGACCTCGACCCC
GTCGCCGGGACCGACCCCGCCGCGCTCGTCGCGGCCCTCGCCGCCGAGGAACCGCAGACC
GCGCTGCGGGGCGACACCGTGTTCGCCGCCCGGCTCGCCCGCGTCCGCCCCGACGGCGAG
ACCACCGCCGCCGCCTGGAACCCCGAGGGGACCGTTGTCGTCACCGGCGGCACCGGCGGC
CTCGGCGCCGCCCTCGCCCGCCACCTCGTCACCGAGCGCGGCGTACGCCACCTGGTGCTC
GCCGGCCGGCGCGGCCCCGACGCCCCCGGCGCCGCCGGACTCGCCGCCGACCTCGGCGCG
CTGGGCGCCGAGGTCACTCTCGCCGCCTGCGACGTCGCCGACCCGGAAGCCGTGGACCGG
CTGTTCGCCGCCGTACCGGCCGCCCACCCCGTCACCGCCGTCGTGCACACCGCCGGCACC
CTCGACGACGGACTGGTCGAATCCCTCACCGAGGAGCGGCTCGCCGCCGTCCTGCGGCCC
AAGGCCGACGCCGTCTGGCATCTGCACCGGGCCACCCGCGACCTCGACCTCGCCGCCTTC
GTGGTGTTCTCCTCCCTCGCCGGTACCACCGGCGCCCCGGGCCAGGCCAACTACGCGGCC
GGCAACGCCTTCCTGGACGCCGTCGCCCGCCTGCGTCGCGACGCCGGGCTGCCCGGCCTC
TCCCTCGGCTGGGGCCCCTGGGTGCCCGTCGACGGCGGCATGACCGGCGAACTCTCCGAG
CGGGACCTGGAGCGCATGTCCCGCTCCGGCACGCCGCCGCTCACCGTCGAACAGGGCCTG
GCCCTCTTCGACGCCACCCTCGCCCTGCCCCGCGCCGCCGTCCTGCCCGTCCGCCTCGAC
CTGGCCGCCCTGCGTGGCCGGGGCGAGGTGCCCCCGCTCCTGCGCGGCCTGGTCCGCACC
CGCGCCCGCCGCACGGTGCGCACCGGTTCCGAGGCCGCCCTCGGCCTCGCCCAGCGGCTC
GCCCGGCTCGACGAACAGGCCCGCACGGAGGCCGTCGTCGACCTGGTGCGCGACCGGACG
GCCGCCGTCCTCGGCCACGCCTCCGCCGCCGACATCGACCCCGAACGCCCCTTCCAGGAG
CTCGGGTTCGACTCCCTGACCGCCGTCGAGCTGCGGAACGGGCTGGCCGCCGCCACCGGC
CTGCGCACCTCCGCCACCGTCATCTTCGACTACCCGACCGTCGCGGCCCTGGCCGGCCAC
CTCCTGGCCGAACTGACCGACGCCCCCGAGGCCGAGGCCCCCGCCCCCGCCCCGCGGACG
TCCGCCACCGCCGACGACCCGATCGTCATCGTCGGCATGAGCTGCCGCTACCCCGGCGGC
GTCGGCTCGCCCGACGACCTGTGGCGCCTGGTCACCGAGGGCACCGACGCGATCGGCGGC
CTGCCCGTCAACCGAGGCTGGGACCTCGACTCCCTCTACCACCCCGACCCGGACCACCCC
GGCACCTCGTACACCCGCTACGGCGGATTCCTGCACGACGCGGGCGAGTTCGACGCGGGC
TTCTTCGGCATGAGCCCCCGTGAGGCGCTCGCCACCGACTCCCAGCAGCGACTGCTGCTG
GAGGCGTCCTGGACAGCCGTCGAGCACGCCGGTATCGACCCGGTGGGCCTGCGCGGCAGC
CGTACCGGTGTCTTCGCCGGCGTCATGTACAGCGACTACTCGGCGACCCTCGCCGACGAG
CGTTTCGAGGGCCACCAGGGCAGCGGGACCGCCCCCAGCATCGCCTCCGGCCGTGTCTCG
TACGCCCTGGGCCTGGAGGGCCCGGCGGTCACCGTCGACACCGCCTGCTCCTCCTCCCTG
GTCGCCATGCACTGGGCGATGCAGGCCCTGCGCTCGGGCGAGTGCTCGCTCGCCCTGGCC
GGCGGCGTCACGGTGATGTCCACGCCGACCTCCCTCATCGAGTTCTCCCGCCAGCGCGGC
CTGTCGCCCGACGGCCGCTGCAAGGCGTTCTCCGACGAGGCCGACGGGGTCGGCTGGTCC
GAGGGCGTCGGCATGCTCGTCCTGGAGCGGCTCTCCGACGCGCGCCGCAACGGCCACCGC
GTCCTCGCGGTGGTCCGGGGGTCCGCCGTCAACCAGGACGGTGCCTCCAACGGCCTGACC
GCCCCCAACGGCCCCTCCCAGCAGCGCGTCATCCGCCAGGCCCTGGACACGGCCGGCCTC
ACCACCGCCGACGTCGACGCGGTCGAGGCACACGGCACCGGCACCGCCCTCGGCGACCCC
ATCGAGGCCCAGGCCCTCCTCGCCACGTACGGCCAGGACCGGCCCGGGGACCGGCCGTTG
CTGCTCGGCTCGGTGAAGTCCAACATCGGCCACACCCAGGCCGCCGCCGGTGTGGCGGGC
ATCATCAAGATGGTCATGGCGATGCGCCACGGCGAACTGCCCCGCACCCTGCACGCCGGC
AGCCCCTCCCGCCACGTCGACTGGGAGACCGGCGACGTCCGCATCCTCCAGGAGCCGGAG
GCGTGGCCCGAGACCGGCCGCCCCCGGCGCGCCGGTGTCTCCTCCTTCGGCATCAGCGGC
ACCAACGCCCACGTCGTCCTGGAACAGGGCGAGTCCGCCCCCGCCGGGTCCACCGGCACC
CCGCCCGCCGAAGCCACCGTCCTGCCCTGGACCCTCTCCGGCCGCACCCGGCCCGCGCTG
CGCGCCCAGGCCGCCCGGCTGCTCGCCCACCTCGACGCGCGCCCCGACGAGGCCCCCGCC
GACCTCACCCACTCGCTGGCCACCACCCGCCCGGCCTTCGAGCAGCGCGCCGTGGTCGTC
GGCACCGCCGACGACGCCCGCCGTGCCCTGGCCGCCCTCGCCGCCGACCGCCCCGACCCG
GCGCTCGTCCTCGGCGAGACCGGTGGCACCGGCCGCACCGCCCTGCTCTTCACCGGCCAG
GGCAGCCAGCGCCCCGGCACCGGCCGCGAACTGTACGAGCGCCACCCGGTCTTCGCCGAG
GCTCTGGACGAGGTCGTCGCGCGCCTGGACCCGCTCCTCGTCGACGCCCCCGCCGGCACC
CCGCACGGCTCCCTCAAGGACGTCATGTTCGCCGAGGAGGGCACCCCGGGCGCCGCCGCC
CTGTACGAGACCGGCTGGACACAGCCCGCCCTGTTCGCCCTGGAGACCGCGCTGTACCGG
CTGGTGCGGTCCTGGGGCGTGCGCCCCGGCGTGCTCCTCGGCCACTCCGTCGGCGGCATC
GGCGCCGCCCACGCCGCAGGCGTCCTCTCCCTGGACGACGCCTGCGCGCTGGTCGCCGCC
CGCGCCCGCCTGATGCAGGCCCTGCCCGAGGGCGGCGCCATGTGGTCGCTCCAGGCGTCC
GAGGACGAGGTCCTGCCCCTGCTCCAGGGGCAGGAGGACGTGGCCGCCCTCGCCGCCGTC
AACGGGCCGTCGGCCGTCGTCGTCTCCGGCGAGGAGGAGGCCACCGCGGCCATCGCCGCG
CACTTCGCCGGCCTCGGCCGCGCCACCCGCCGGCTGCGGGTCAGCCACGCCTTCCACTCG
CCCCGCATGGACGCCGTGCTGGACGCCTTCCGCGAGGTCGCCGAGGGCCTGACGTACCAC
GAGCCCACCGTCCCCGTGGCCTGCGACCTCACGGGCCGCCTCGCCGAGGGCGACCACCTG
CGGACCGCCGACTACTGGGTCCGCCACGTGCGCTCCACCGTCCGCTTCGCCGACGCCGTG
CGCGCCGCCCACGAGGCCGGCGCCACCACCTACCTCGAACTGGGCCCCGGCGGCTCCCTG
TGCGCCGCCGCCCAGGACACCCTCGGTGACGACAGCGAGGCCGACGCCGTCCCGACGCTG
CGCACCGGCCGACCGGAGGACGAGTCCGTCCTCACCGCCCTCGCCCGGCTCCACGTCCGC
GGCGTCCGCGTCGACTGGGGCGCGGTCCACCCGGCAGGCGCCGGCACCGTCGAGCTGCCT
ACGTACGCCTTCCAGCACGAGACCTACTGGCCGGACACCACCGCGCCGACCGTGCGCCGC
ACCGGTGACGGCTCCGGCGACCCGGCCGACGCCGAGCTGTGGACCGCCGTCGAACGCGGC
GACGCCACCGGGCTCGCCGGGCTCCTCGGTCTGCGCGACGAGGAACACGCCTCCCTCTAC
ACGCTGCTGCCGTCGCTGAGCTCCTGGCGCCGCGCCCGTCAGGAACGCGCCGTCCTCGAC
GCGGCCCGCTACCGGATCGCCTGGCAGCCCGCCGGTACTGAGAGCGCCCCGGTGCTCGAC
GGGACCTGGCTGGCCGTCACCACCGAGGACGACGGCGCGGCCGACACCGTCCTCGCCGCC
CTGCGCGGCCACGGCGCCGTCGTCGAGCGCCTGGTGCTCGACGCCTCCCACCTCGACCGC
GACCTCCTCACCACCACCCTGCGCGACGCCGTCGAGAACGCCACGGCCGAAGGCGCCGCC
GGTGTCCGCGGCATCCTGTCGCTGCTGCCGCTCGCCGACGCCGCCCGCCCCGAGGCCACC
GGCACCGACGCACCGGCCGGCGGACTCCCGGCCGGCTTCGCCCTCGGCGTGGTCCTCGCC
CAGGCCCTCGGCGACGCCGCCGTTACCGCCCCGCTGTGGACGGTCACCCGCGGTGCCGTC
TCCACCGGCCCCGGCGACCCGCTCACCCACCCCGCCCGTGCCGCCGCCTGGGGCCTGGGC
CGGGTCGCCGCCCTGGAACGCCCCGAGCAGTGGAGCGGACTGGTCGACCTGCCGGAGGTC
CTCGACGCCCCGGCCACCCAGCGGCTGGTCAGCCTCCTCGCCACCCGCGACGGCGAGGAC
CAGCTCGCCGTCCGCGCGGGCGGCACCCTGGCCCGCCGCGTCGTCCGGCACCCCGGCGAC
GCCCTGCCCCGCGAGGACGAGTTCACCGCCTCCGGCACCGTCCTGGTCACCGGCGGCACC
GGCGGTCTCGGCGCCGAGGCCGCGCGCTGGCTCGCCCGCTCCGGCGCCGCCCACCTCGTC
CTCACCGGCCGCCGCGGCCCCGACGCCCCCGGCGCCGCCGAACTCCGCGCCGAACTGGAG
GAACTGGGCGCCCGCGTCACCCTCACCGCCTGCGACAGCGCCGACCGCGACGCCCTCGCC
GCCGTCCTCGCCGCGGTGCCCGAGGACGCCCCCCTCACCGGCGTCGTGCACGCCGCCGGC
GTCGGCCAGGCCGCGCCGCTCGCCGACACCCCGCTCGACCAGGTCGCCGCCGCCATGGCC
GCCAAGACCCTCGGCGCCGCCCACCTCGACGCCCTCCTCGACGGCCACGACCTCGACTTC
CTCGTCCTGGTCTCCTCCGTCGCCGGGGTCTGGGGGAGCGCGGGCCAGAGCGCCTACGCC
GCCGCCAACGCCTACCTCGACGCGCTCGCCGAGAACCGCCGCTCGCGCGGCCTCGCCGCC
ACCTCCGTCGCCTGGGGCCCCTGGGCCGAGGTCGGCATGGCCAGCGCCCACCGGACCGTC
TCGGAGAACCTGGAACGCGCCGGCCTGCGGCTGCTGAACCCCGCCACCGCCATGACGGAG
CTGCGCCGGGCCGTCGTACGCGGCGAGACCACCGTGACCGTCGCCGACGTCGACTGGGAG
CAGTACCACCCGGTCTTCACCGCCGCCCGGTCCAGCCGCCTCTTCGACACCGTCGACACC
GTCGCGGCCCTCGCTGCTCCCGGGAGCACCGGCACCGTCTCCGGGCTGGCGGAGCGCCTC
GGCGGCCTCACCGAGCAGGAACAGGAGCGGCTGCTCGTCGACCTCGTGCGGGCCGAGGCC
GCCGTGGTGCTCGGCCACACCTCCGCCGAGGGGGTGCCGGTCAAAAAGGCGTTCCGTGAC
GCCGGGTTCGACTCGCTGACCGCCGTCGAACTGCGCAAGCGCCTCGCCCACCTCACCGGA
CTCGCGCTGCCGAGCACCCTGGTCTTCGACTACCCGAACCCGCTCGCCCTCGCGCGCCAC
CTGCGTGCCGAACTCCTCGGCACGGTCGAGACCGCCCCCGTGGCGACCGGCCCCGCCGTC
ACCGACGAGCCCATCGCCATCATCGGCATGAGCTGCCGCTTCCCCGGCGGCGCCCGCTCC
GCCGACGCCTTCTGGCAGCTCGTCGCCGACAACACCGACGCGATCTCGGAGTTCCCCGTC
AACCGGGGCTGGGACGGCGACGCGCTGTACGACCCGGACCCCGACCGGCCCGGCACCACC
TACTCCACGCAGGGCGGATTCCTGCACGACGCGGGCGAGTTCGACGCCGGGTTCTTCGGC
ATCTCGCCGCGCGAGGCCGTCTCCATGGACCCGCAGCAGCGCCTCCTGCTGGAGACCACC
TGGGAGGCGTTCGAGCACGCGGGCATCGACCCGGCCGCCGTGCACTCCACGCCCACCGGC
ACCTTCATCGGCTCCACGTACCAGGACTACGGCGTCTCCATGGACGACGGGTCCGCGGGC
CACGCCGTCACGGGCTCCAGCCCCAGCGTGCTCTCCGGCCGCCTCGCCTACTCCTTCGGC
CTGGAGGGCCCGGCCGTCACCGTCGACACCGCCTGCTCCTCGTCGCTGGTGGCGCTCCAC
CTGGCCTGCCAGTCGCTGCGCAACGGCGAGACCACCCTCGCCCTGGCGGGCGGCGCCACC
GTCATGACCAACCCGATGCCGTTCATCGCCTTCAGCCGGCAACGGGCCCTCGCCCGGGAC
GGCCGCTGCAAGGCCTTCTCCGAGAGCGCCGACGGCATGACCCTCGCCGAGGGCGTCGGC
ATCCTCGTCCTGGAGCGGCTCTCCGACGCCCGCCGCAACGGCCACGAGGTCCTCGCCGTC
GTCCGCGGCTCCGCCATCAACCAGGACGGCGCCTCCAACGGCCTGACCGCCCCCAACGGC
CCCTCCCAGGTCCGCGTCATCCGCCAGGCGCTGGCCGCCTCCGGCCTCACCACCGACGAC
ATCGACGCGGTCGAGGCACACGGCACCGGCACCGCCCTCGGCGACCCCATCGAGGCCCAG
GCCCTGCACGCCACCTACGGCAGGGACCGCGACCCCGAGAACCCGCTGCTGCTCGGCTCG
GTGAAGTCCAACATCGGCCACACCCAGTCGGCCGCCGGCGTCGCGGGCATCATCAAGATG
GTCATGGCGATGCGCCACGGCACCCTGCCGCGCACCCTGCACGCCACGGAGCCCTCCAGC
CACATCGACTGGTCCGGCGGCACCGTCCGCCTCGTCACCGAGAACACCGGCTGGGCCCGG
GACGACCGCCCGCTGCGCGCCGCCGTCTCCTCCTTCGGCATCAGCGGCACCAACGCGCAC
GCCATCCTGGAACAGGCGGCCCCCGCCGAGGAGCCCGCCCCCGCCGCCGGACCCGCCCTG
CCCACGGGCGGCACCCTGCCGTGGATCCTCTCGGCCGCCGCCCCCTCCGCCCTGCGCGAG
CAGGCCGCCAACCTCGCCGCCCACGTCACCTCCGGCGCGGCACCGCACCCCGCCGACGTC
GGCCACACCCTGATCACCGCACGCTCCGTCCTGGAGCACCGCGCCGTCGCCCTCGGCGCG
GACGCCGGCGAACTCACCGACGCGCTCGCCGCGTTCGGCGCCGGCGAGTCCACCGGCCAG
GTGGTCCACGGCACCGCCGACACCGACGGCCGCACCGTCTTCGTCTTCCCCGGCCAGGGC
TCCCAGTGGGCCGGCATGGGCGCCGAACTCCTCGACACGTCACCGGTGTTCGCCGAGCGG
CTCCACGCCTGCGCGGCCGCCCTGGCCCCGTACACCGACTGGGACCTCGTCGACGTCGTC
CGCCAGGCCGACGGCGCGCCGACCCTGGACCGGGTCGACGTCGTGCAGCCCGCGACCTGG
GCCGTGATGGTCTCCCTCGCGGAGCTGTGGCGGGCCCACGGCGTCACCCCCGACGCCGTG
ATCGGCCACTCCCAGGGCGAGATCGCCGCCGCCGTCGTCTCCGGCGCCCTCACCCTCGAC
GACGGCGCCCGCGTCGTCGCCCTGCGCTCCCAGGCGATCCGCCGGGTCCTGGCCGGGGCC
GGCGGCATGATGTCCGTCCAGGTCTCCGCCGCCGAGGCCGAGCAGTACCTGACCCCCCAC
GCGGGAGCGGTCTCCGTCGCCGCCGTCAACGGCCCGCGCTCCGTCGTCCTCGCCGGTACG
CCCGAGGCCCTGGACGCCCTCCAGGCGGAGTTCGCCGCCCGCGACCTGCGTGCCCGCCGG
ATCGCCGTGGACTACGCCTCCCACACGGCACAGGTGGAGCGGATCGAGGCCGAACTCCTC
GACCTCCTCGCCCCGGTGGCACCGCGCGCCGCCCGGGTCCCGTTCCACTCCACGGTCACC
GGCGCCACGCTCGACACCACCGGCATGGACGCCGCCTACTGGTACCGCAACCTGCGGCAG
ACCGTCCGCTTCGAGGACGGCGTGCGCGCCCTGCTCGACACCGAACACACGCTCTTCGTC
GAGATCAGCCCGCACCCCGTGCTGACCATGGCCGTCCAGGCCACCGCCGAGGAGGCCGGC
CGCCCGGCCGCCGCCGTCGGCACCCTGCGCCGCGAACAGGGCGGCACCGCGCGCTTCCTC
ACCTCCCTCGCCGAACAGTGGGTACGCGGCGGCCGGGCCGACTGGAACGCGGTCTACGCG
GACACCGGCGCCCGCAGGACACCCCTGCCCACCTACGCCTTCCAGCGTGAGCACCTGTGG
GCCGTCTCCGCCCGCCCGCAGGGCTCCGGCGACGGCGACCCCGCCGACGCCGAGTTCTGG
GCCGAGGTCGAGCAGGAGGACGCGGAGTCCCTCGCCTCCCGCCTGGAACTCGACCGGGAG
GCGCTCGCCCCGCTGCTGCCCGCCCTCTCCACCTGGCGCCGTGGCAGGCGCGACCGTTCC
ACCGTCGGGTCCTGGCGCTACCGCGCCACCTGGAAGCCGCTCGGCGCGCTCCCCTCCGCG
ACCCTGGACGGCACCTGGCTGCTCGTCACCGCGGAGGGCACCGACCCCGAGTACGCCGCC
GCCGTGGCGGAGCAGCTGACCGCGCACGGCGCGCGGACCGTGCCCCTCGCGCTGACCGGG
GCCGACGCCGACCGGGCGGCTCTCACGGAGCGGCTGCGCGACCTGCCCGAACCGGCCGCG
GTGGTCTCCCTGCTGGCCGACGACGAGTCCACCGGCGCCGCCCACCCGGTCCTCACCACC
GGTCTCGCCCTCAGCGTCACGCTGACGCAGGCCCTCGGCGACGCCGGGATCGAGGCACCC
CTGTGGGCGCTGACCCGCGGCGCCGTCTCCACCGGGCGCGCCGACCGCCTCACCCGGCCC
GCCCAGGCCCTCGTCCAGGGCTTCGGCTGGACCGCGGCCCTGGAACACCCGGACCGGTGG
GGCGGCACCGTCGACCTGCCCGAGACCCTGGACCGCCGGGCGGGCGAACGCCTCGCCGCC
GTCCTGGCCGGCACCACCGGCGAGGACCAGCTGGCCGTCCGCGCCTCCGGCGTCCTGGCC
CGCCGCGTCTCCCCGGCCCCGGCGCCCACCGGCACCGGCCGCTGGAGCCCGCGCGGCACC
GTCCTGGTCACCGGCGGCACCGGAACGCTCGGCCCGCACCTGGCCCGCTGGCTCGCCGAC
CAGGGCGCCCGCGACCTGGTCCTCACCAGCCGCCGCGGCGCGGACGCCCCCGGCGCCGCC
GAACTCGCCGCCGAACTCGGCGAACGCGGCTGCCGGGTGACCGTCGCCGCCTGCGACGTC
ACCGACCGCGAGGCGGTCGCCGCGCTCCTCGACGGCCTCACCGCCGAGGGCCGCACCGTC
CGCAGCGTCTTCCACACCGCCGCCGTCATCGAGCTCCAGTCCATCGAGGAGACCAGCCTC
GACGCGTTCGCCAAGGTCGTCCACGCCAAGACCGCGGGCGCCGCCCACCTCGACGAACTC
CTCGACGACGACCAGCTCGACGCCTTCGTCCTCTACTCGTCCACCGCCGGTATGTGGGGG
AGTGGCCGGCACGCCGCGTACGTCGCCGCCAACGCCCACGTCAACGCGCTCGCCGAGCAC
CGGTGCGCCCGAGGCGCCCACGGCACCGCCGTCTCCTGGGGCATCTGGGCCGACGACATG
AAGCTCGGCCGGGTCGACCCCGGCCAGATCCGCCGCAGCGGCCTGGAGTTCATGGACCCG
CGCCTCGCCCTCGCCGGGCTCCGGCAGGTCCTCGACGGGGACCAGGGCGCCGTCGCCGTC
GCCGACGTCGACTGGGACCGCTACCACCCCGTCTTCACCTCCTCGCGGCCCACCGAACTC
TTCGAGAACGTGCCCGAGGTCCGCCGCCTCACCGAGCAGCAGGAGGCCCGCGCCGGCGAG
GCCGGAGAGTTCATCCACCGCCTGCGCTCCCTGCCCGCCGGCGAGCAGGACCGCCTCCTG
CTGGAACTCGTCCGCTCGGAGGCGGCCACCGTCCTCGGCCACGCCTCCCCGGAGGTGCTG
TCGGAGCGTCGCGCCTTCCGTGACATCGGGTTCGACTCGCTCACCGCGGTCGACCTGCGC
AACCGGCTGGCTTCCGTCACCGGCCTCACCCTGCCGAGCACCCTCGTGTTCGACTACCCG
GACCCGCTCACCCTCGTGGGCCACCTGCGGGGCCTGGCCGGCGGTCCCGCCGCCGGCCCC
GACGGCCCGGTCCGCACCACGGCCGCCACCGACGACGAGCCGATCGCCGTCGTCGCGATG
AGCTGCCGCTACCCGGGCGGCGTCACCTCGCCCGAGGCCCTGTGGGAGCTGATCGCGGCC
GGCGCCGACGCCATCACCGGCTTCCCCGCCGACCGGGGCTGGGACGCCGACGCCCTCTAC
GACCCGGACCCCGACCGGCCCGGCACCACCTACTCCACGCAGGGCGGATTCCTCCACGAC
GTCGCCGACTTCGACGCCGGCTTCTTCGGGATCTCCCCGCGTGAGGCACTGGCGATGGAC
CCCCAGCAGCGCCTGCTGCTGGAGACCGGCTGGGAGGCGATCGAGCGCGCGGGCATCGAC
CCCGCGACCCTGCGCGGAAGCATGACCGGCACCTTCATCGGCGCCAGCTACCAGGACTAC
ACCGCGGGCGGCGCCGGCTCCGAGGGCGCCGAGGACCACCTGATCACCGGCACCATCTCC
AGCGTGATGTCCGGCCGGCTCGCCTACACCTTCGGCCTGGAGGGCCCGGCCGTCACCCTG
GACACCGCCTGCTCCTCCTCCCTGGTCGCGCTCCACCTGGCCTGCCAGTCGCTGCGCAAC
GGCGAGTCCACCCTCGCCCTGGCGGGCGGCGTCAGCGTCATGGCCACCCCGCAGGCGTTC
ACCGGCTTCAGCCGCCAGCGCGCGATGGCCCCCGACGGCCGCTGCAAGGCGTACGCCGAG
GGCGCCGACGGCATGAGCCTGGCCGAGGGCGTCGGCCTGGTCCTCGTCGAGCGGCTGTCC
GACGCGCGCCGCAACGGCCACCCCGTCCTCGCCGTCATCCGGGGCTCCGCCGTCAACCAG
GACGGCGCCTCCAACGGCCTCACCGCCCCCAACGGCCCCTCCCAGGCGCGCGTCATACGC
CAGGCCCTCGCCAACGCCCGGCTCACCCCGGGCGAGGTGGACGTGGTCGAGGGCCACGGC
ACCGGCACCGCCCTCGGCGACCCCATCGAGGCCCAGGCCCTGCTGGCGACGTACGGCCAG
GACCGGCCCGGGGACCGGCCGCTGCTGCTCGGCTCGGTGAAGTCCAACATCGGCCACACC
CAGATGGCCTCCGGCATCGCCGGTGTCATGAAGATGGTCATGGCGATGCGGCACGGCACC
GTCCCGCGCACCCTGCACGTCGACACCCCCTCCAGCCACGTCGACTGGGGCTCCGGCGCC
ATCGACCTGGCCACCGAGACCGTGCCGTGGCCCGAGACCGGACGCCCGCACCGGGCCGCC
GTCTCCTCCTTCGGCCTCTCCGGCACCAACGTCCACACCATCGTCGAGCAGGCGCCCGAG
GAGCCCGCGACCGAGCCCTCCGCGTCCCCGGCCCCCGCCGGCGACCCGGCCACCCTGCCC
CCGGGCGTCCCCGTCGTGCTCTCCGCCCGGACCCCGGCCGCCCTGCGCGAGCAGGCCGAG
CGGCTCGCCGGACACCTCGCCGGCCGTCCGGACGTACCGCTGGTGGACCTGGCCCACTCG
CTGGCCACCACCCGTGGCGTCCTGGAGCACCGCGCCGCCGTCCTCACCGGCGACCGGGAC
GGCCTGCTGCGGGCGCTCACCGCGCTGCGCGAGGGCGCCCCCGACGCCTCGCTGCTCACC
GGCGCCCCCGCACGAGGAGGGCTCGCCTTCCTCTTCACCGGCCAGGGCAGCCAGCGCCCG
GCCATGGGACGGGACCTGTACGAGCGTCACCCGGTCTTCGGCGAAGCCCTGGACGCGGTC
CTCACCCGCTTCGACCAGGAACTGGACCGCCCGCTGCGCGAGGTGCTCTTCGCCGAGGAG
GGCACCGCCGAGGCCGCGCTCCTGGACGACACGGCGTACACGCAACCCGCCCTGTTCGCC
CTCGAAGTGGCGCTGTACCGGCTCGTCGAGTCCTGGGGGGTACGCCCCGACCAGGTCGCC
GGCCACTCCGTCGGTGAGATCGCCGCCGCCCACGTGGCGGGGGTCTTCTCCCTGGACGAC
GCCTGCGCCCTCGTCGCCGCCCGTGGCCGCCTCATGGCCGCCCTTCCGGCGGGCGGCGCC
ATGGTCGCCGTCGAGGCGAGCGAGGAAGAGGTACTGCCCCTCCTGGAGGGAGGCGAGGAC
CGGATCTCCCTCGCCGCGGTCAACGGCCCGCGCGCCGTGGTGATCGCCGGTGACGAGGAG
CCGGTCGCCGCCGTCGCCGCCCGCCTCGCCGAGGACGGCCGCCGCACCCGCGCGCTGAAG
GTCAGCCACGCCTTCCACTCGCCGCGCATGGACGCCATGCTCGACGACTTCGCCCGCGTC
GCCCGCGGCCTCACCTACGAGACGCCGCTCGTGCCGGTGGTCTCCACCGTCACCGGCGCC
CCCGCCACCCCCGAGGAACTGCGTTCGCCCGAGTACTGGGTCGGCCAGGTCCGTGCCACC
GTCCGGTTCGCCGACGCCGTGCGCACCCTCGCCCGCCAGGGCGTCACCTCCTGCCTGGAA
CTCGGTCCCGACGGCACCCTCTCCGCCGCCGCCCGCGACGTCCTCGACGCCGACCCGGCC
GACGCCACCGGCGCCCGGCCCGTCACCGTCGTCCCCGCGCTGCGCCGCGACCGCGACGAG
GTGCCGTTCCTCACCGCCGCCCTCGCCCGGCTGCACGTCCACGGCACCGCCGTCGACTGG
ACCGGCGCCTTTGAGGGCACCGGCGCCCGCCGCGTCGACCTGCCCACCTACGCCTTCCAG
CGCAGCCGCTACTGGCCCGACACCACCTTCACCCCGGCCACGGCCGCGGGCCCCGCCGAC
ACCGGCGCCGACGCCGCGTTCTGGTCGGCCGTCGAGCGGGCCGACCTGCCCACGCTCGGC
GCCGACCTCGGCCTGGACGACGACACGCTGTCCGCCCTGGTGCCGGCCCTGTCCTCGTGG
CGGCGCCGCCGCACCGCACAGGCCGCCGCCGACGGCCGCCGCCACCGGATCGTGTGGAAG
CCGCTCGACGGCGCCCCCACCGGACGGCCCGAGGGCACCTGGCTGGTCCTGCGTCCCACC
GGTACGGCCGCGCCCGAGACCGCCGCCCTCCTGGACACCCTCGGCCTGGACACCGCCGAG
GTCACCGTCGACCTCGCGGCCCCCGACCGTGCCGCGCTCGCCGACACCCTGCGCCGGCTG
CCGCGCCCCGAGGACGGCTTCACCGGCGTCCTCGCCCTGCCGGCCCTCGACACCGCCGCC
ACCGCCGACGACGTGGCAGGGACGGGCGCCGTGGCGCCGACGGCCGCCGCCCTGAACGCC
CTGGACGACGCCGGGATCACCGCGCCCCTGTGGATCGTCACCCGGCAGGCCGTGAGCACC
GGACGCGCCGACCGGCTGGCCCGTCCCGGGCAGGCGGGTGTGTGGGGGCTCGGCCGGGTC
GCCGCCCTGGAGAACCCCGGACGCCGCCTCGCCCTGGTCGACCTGCCCGAGCAGTTCGAC
ACCCGCGTCGCCCGCCGGCTGGCGCACCTCCTGGCCGTGCCCGGCACGGAGAACCAGCTC
GCCGTCCGCGCCTCCGCCACCTACGCGCGGCGGATCGCCCACCACCCGGCGCCCCAGGAA
CCGGCGCGTCCGTTCGCCCCCGAGGGCACCGTCCTGATCACCGGCGGTACCGGCGCCCTC
GGCGCCCACGTCGCCCGGCTCCTGGCCGGGCGCGGCACGCCGCACCTGCTGCTGACCAGC
CGGCGCGGCGCGGACGCCCCCGGCGCCGCCGAACTCGCCGCCGAGCTGCGGGAACTGGGC
GCCGAGGTCACCCTCGCCGCCTGCGACACCGCCGACCGGGAGGCGCTCGCCGCGCTCCTG
GCCGAGGTGCCCGCCGACCGCCCCCTCACCACCGTGGTGCACGCGGCGGGCGTCCTCGAC
GACGGCCTCCTGGACACCCTCACCCCGGAGCGGTTCGCCGCCGTCCTCGACGCCAAGGCC
CGCTCCGCCGCCCACCTGCACGAGCTGACCCGCGACCTCGGCCTCACCGACTTCGTCCTG
TTCTCCTCGACCGCCGGTACCCTCGGCGCCGCCGGCCAGGCCAACTACGCCGCCGCCAAC
GCCTACCTCGACGCCCTCGCCGAACACCGGCGCGAACAGGGCCTGCCTGCCACCTCGGTG
GCCTGGGGCCCCTGGTCCGGCACCGGCATGGCCGGCGAGGGCACCGGCGTCGAGGACCGG
GTCCGCCGTGGCGGCTTCACCCCGATGAGCCCCGAGGACGCCCTCGCCGCCCTCGACGCC
GCCGTCGGCCACCGCGACACCGCGCTCCTCGTCGCCGACATCGACTGGCAGCGCTACGCC
ACCGTCTTCGCCCCGCACCGCGCCCTCGTCGGCGACCTGCCCGAGGTACGCGCCACCGTC
GGCGCGGCCACCGCCCACGGCGACACCGAACCGGCGCTGCGCCGCCAGGTCGCCGCCCTG
ACCGGCCCCGCCCGCGAGCGGTACGTGCTGGACTTCCTGCGCGCCCAGGTCGCCGCCGTC
CTCGGTCACCCCGACCCGGACGCCGTCGAGGCCGACCAGGCCTTCACCGACCTCGGCTTC
GACTCCCTCACCACCGTCGAACTGCGCAACACCCTGGGCGCCACCACCGGCCTGCGGCTG
CCCGCCACCCTCGTCTACGACCACCCGACCGCCCGCGACCTGGCCGCTCACCTCCTGACC
GAGATCCTGGGCGACCTGCCCGAGCCGGCGGCGGGCGGGAACGCGGCCGGCGAGGCTCCC
CGCGCCACGGAGACCGACCCGGTCGTCGTGGTCGGCATGGGCTGCCGCTTCCCCGGCGGT
GTCGAGTCGCCCGAGGAGCTCTGGCAGCTCCTCGGCGAGGGCCGCGACGCCGTCTCCGGC
TTCCCGGCCGACCGCGGCTGGGACCTGGACTCGCTGGCCCGTGGCGGCTCCGCCACCCTG
GAGGGCGGCTTCCTCCAGGGCGCCGGACTCTTCGACGCCTCGTTCTTCGGCATCTCCCCG
CGCGAGGCCCTTGCGATGGACCCGCAGCAGCGCCTGCTGCTGGAGACCTCCTGGGAGGCC
CTGGAGCGGGCCGGCATCGACCCGACGGGCCTGCGCTCCAGCGCCACCGGCGTCTTCGTC
GGCACCAACGGCCAGGACTACGCCACCGTGCTGCGGCGCGGCACCACCGACGTGCGCGGC
CACGCCGCGACCGGCACCACCGCCAGCGTGATGTCCGGCCGCCTGTCCTACACCCTGGGC
CTGGAGGGCCCGGCGGTCACCGTCGACACCGCCTGCTCCTCGGCGCTGGTGGCCCTGCAC
ATGGCCGCCGGGGCGCTGCGCTCCGGCGAGTGCACCCTGGCCCTCGCCGGCGGCGTCTCG
GTGATGGCGAGCCCGGACGCCTTCGTGGAGTTCACCGCGCAGGGCGGCCTGGCCGGCGAC
GGCCGCTGCAAGGCGTTCGCCGACGCCGCGGACGGCACCGCCTGGGGCGAGGGCGCCGGC
GTCCTCGTCCTGGAGCGGCTCTCCGACGCCCGTCGTCACGGCCACCCGGTCCTCGCCGTG
CTGCGCGGCTCCGCCGTCAACCAGGACGGCGCCTCCAACGGCCTCACCGCGCCCAACGGC
CGCGCCCAGCAGCGCGTCATCCGCCAGGCGCTGGCCGACGCGCACCTCACCCCGGCGGAG
GTCGACGCCGTCGAGGCGCACGGCACCGGCACCACCCTGGGCGACCCGATCGAGGCCCAC
GCCCTGATCGCCGCCTACGGCGAGGGCCGCGACCCGGAGCAGCCGCTGCTGCTCGGCACC
GTCAAGTCCAACCTGGGCCACACCCAGGCCGCCGCGGGCGCCGCCGGTGTCATCAAGACC
GTCCTCGCCCTGGGCCACGGCGAACTGCCGCGCACCCTGCACGTCGACGCGCCGTCCTCG
CACGTCGACTGGTCCGACGGCACCGTGGAACTGCTCCGCGAGCACCGCGCCTGGCCCGAG
ACGGGCCGTGCGCGCCGGGCGGGCGTCTCCGCCTTCGGCGTGAGCGGCACCAACGCGCAC
GTCATCCTGGAGCAGCCCGAACCGGCCACCGCCGAGACCCCGGAACCGGTCACCGAGCCG
TCCGTCGTGCCCTGGCTGGTCTCGGCCCGCTCGGAGGACGCCCTGGCGGCCCAGACCGCG
CGGCTGACCGCCTTCACACAGGCCCGGCCCGAGGTCCCCGCGCTCGACACCGCCTACAGC
CTGGCCACCGGCCGAGGGGCCTTCGCCCACCGCGCCGTCCACCTGGTCACCGCCGGGGGC
GAACCCCTGGAGACCGTCCGCGACCGCGCCTGGGAACGCCGCCTCGCCCTGCTCTTCTCG
GGCCAGGGTTCGCAGCGTGCGGGGATGGGCCGGGAGTTGTACGAGCGTTTCCCGGTGTTC
GCGGAGGCGCTGGACTCGGTGGTGGCCCGTCTGGACACGGGGCTGGAGCGTTCGCTGCGG
GAGGTGCTGTTCGCTGAGGAGGGTTCCGAGGCGGCGGCGCTGCTGGAGGCGACCGGGTAC
ACGCAGCCGGCGCTGTTCGCGGTGGAGGTGGCGTTGTTCCGGCTGGTGGAGTCGTGGGGT
GTCGCGCCGGAGTTCGTGGCGGGTCATTCGGTCGGCGAGATCGCGGCGGCGCACGTGGCG
GGAGTCTTCTCGCTCGACGACGCCTGCGCGCTGGTCGCCGCCCGCGCCCGCCTGATGCAG
GAACTCCCCACGGGCGGGGCGATGGTGGCCGTGCGGGCGACCGAGGCCGAGGTCGTGCCC
CGGCTGACCGAGGGCCTGTCCCTCGCCGCCGTGAACGGTCCCGACTCCGTCGTCATCGCC
GGTGAGCAGGAGGAAGTCCTGGCCCTGGCGGCCGAGTTCGCGGGGGAGGGGCACAAGACG
CAGCCTCTGCCGGTCAGTCACGCCTTCCACTCGGCGCTGATGGAACCGATGCTCGCCGAG
TTCCGCCGGGTCGCGGAGAGCCTGGAGTACGCCGAGCCGCGCGTCCCGGTGGTCTCCAAC
GTCACCGGCGCCCTCGCCCAGCCCGGTCAGCTCACCGACCCCGAGTACTGGGTGCGGCAC
GTCCGCGAGACCGTCCGCTTCGCCGACGGCGTCCGCGCCCTCGCCGAGGCGGGAGCCGAC
GCCTACCTGGAGATCGGCCCCGACGGGGTCCTCACCGGCATGGCCGCCCGGGTCCTCGAC
ACGGCCGCCGACGGAAGCGGCGGCGTGAGCGTCCCGGCGCTGCGCAAGGACCGACCCGAG
GAACACTCGCTGCTCACCGCCCTGGCCCGGCTCCACACCGCCGGTGTCGCCGTCGACTGG
ACCGCCTGGTTCACCGGCACCGGCGCCCGCCGCACCGACCTGCCGACCTACGCCTTCCAG
CGCGAGCTGTACTGGCCCGAGCCGGCCACCGGGCCGCACACGGCCACCGCGCAGGACCCG
GCGGACGCCGCGTTCTGGGCCGCCGTGGAGCGCGAGGACCTGGAGTCGCTCTCCGCCACC
CTCGACCTGGACGACGCGGTCCTGTCGAACGTGCTGCCCGCCCTCTCCACCTGGCGCCGT
GGCCTGTCCGAGCGCACCCTGCTCGACGGCTGGCGCTACCGCGTCACCTGGCAGCCCGTC
CCCCTCGGGAACACCGCCGACGACGGAACGGGCCGACCCTGGCTGGTCCTGACCCTGGCC
GGGCACGACGACGCGTGGACCCAGGCCCTGGCCGCCACCTTCGGCGAGCACACCGTCCAC
CTCGCCGTCCCCGCCGACGAGGACGGCACCGCCGCCCTGCTCGACGGGGCCGCCGACGGC
ACCGCGTACGCCGGTGTCCTCTCGCTGCTCGCCGGCACCGCGACGGACGGCACCGCCCGC
CCCGACACCCTGCTCCGCCTGCTGGCGGCCGCCGGGATCGACGCCCCGCTGTGGTGCGTC
ACCCGCGACGCCGTCTCCGTCGGCCGCTCCGACCCGGCGGCCGACCCGGACCGCGCCGCC
CTGTGGGGCCTGGGCCGGGTACTCGCCCTGGACGAGCCCGAACGGTGGGGCGGACTGGTC
GACGTCGACCACGTCGCCGACGCCCGCACCGTCGACCGTCTGCGCGCCGTCCTGACCGTC
GCCCGCACCGACGGCCCGGCCGAGGACCAGGTGGCGCTGCGCGCCTCCGGCGCCTTCGGC
CGCCGGCTGTCCCGGGCCGCCGCTCCCGCTCCGGACATCACCTGGCACCCCGCCGGGACC
GTCCTGGTCACGGGCCGGGCGGAGGGCTTCGGCGGGCACGTCGCCCGCTGGCTCGCCGCG
CACGGCGCCACCGGGGTGCTGCTCGCCGGCCCGGCCGGCCCCGAGGACGCCGCCACCACC
GCCCTGCGTGCCGAGGTGGAGGCGCTCGGCGCCACCCTCACCGTCGTCCGCCACCCCGAC
CCGGCCGACGCCGCCCCGCTCACCGAGGCGCTGGCGGCGCAGGCCGACGACCGGCCGCTG
ACCGCCGTCCTCCACACCGGGGACACCGGCGAGGAGACGCCCGGTGTCACCGGGGCGCGC
GCCGCCTACGAGGCGCTGACCACCGCCGTCGGCGACCGTGACCTGGACGCCTTCGTCGTC
TTCGGCTCCATCTCCGCCGTCTGGGGCGTCGGCGGCCAGGGCGCGGGCGCCGCGGCCGGA
GTCTGCCTGGACGCCCTCGTCCAGCGACACCGCGCCCACGGCACCAACGCCGTCTCGGTC
TCCTGGGGCGCCTGGCAGGGCGCCGGGCCGGACGGTCTCGCCGCCCACCTGCGCGCCAAC
GGCCTGCCCGCCATGGAGCCGGCCCGCGCGCTCGACGCCCTCGCCCCCGCGATCGGCGAG
GCCGCCGCCAACCCGGCCGCTCCCGCCTCGGTGACCGTCGCGGACGTGGCCTGGGACCGG
TTCGCCCCGGCGTTCACCCGCACCCGCGCCGGTCTGCTCCTCACCGGCGTGCCCGAGGCC
CGCGAGGCCCTGAGCACCACCGGTGGCGACGGCGCGGACGCCGGTACCGCCTCCGCGCTG
CGCGAGCGGCTGCGGCAGTCCGACCCCTCCGAGCGTCCGCGCACCCTCCTCGACACCGTG
CTCACCGAGATCGCCTCGGTGCTGGGCCACACCGGCGCCGCCGCCGTCCCGGCCGAGAAC
GCCTTCAACGACCTCGGCTTCGACTCGCTCACCGCGGTCGACCTGCGCAACCGCCTCACC
ACGGCCACCGGGCTCACCCTGCCCGCGACCCTGGTCTTCGACTACCCGACCCCCGCCGCG
CTCGCCGCCCACCTCCTCACCGAACTCCTCGGCGAGGACACCGGGCCCGGCACCGGCGCC
CCCGTGGCACGCGCCGCCGCCGACGCGGACGACCCCGTCGTCATCGTCGGCATGAGCTGC
CGCTACCCCGGCGACGTCCGCTCGCCCGAGGACCTGTGGGAACTGGTCGGGGCCGGTACC
GACGCCATCGGCGGCTTCCCCACCGACCGTGGCTGGGACCTGGAGAAGCTGCTCCACGGC
GACGAGGACGGCCGGGGCCGCAGCGTCACCCGCGAGGGCGGATTCCTCTACGACGTCGCC
GACTTCGACCCCGCCTTCTTCGGGATCTCCCCGCGCGAGGCCCTGGTCATCGACCCGCAG
CAGCGGATCGTCCTCCAGGCCGCCTGGGAGGCGCTGGAGCGGGCCGGGATCGACCCCGCC
GTGCTGCGCGGCGGCGACACCGGTGTCTTCGTCGGCGGCGGCAGCGGCGACTACCGTCCC
GCCATCGGGCAGTCCGGGCACGTCGAGACCGCCCAGTCGGCGAGCCTCCTCTCCGGACGG
CTCTCCTACACCCTCGGCCTGGAGGGCCCCTCCGTCAGCGTCGACACGGCCTGCTCGTCG
TCCCTGACCGCCCTGCACCTCGCCGCGCAGGCGATCCGCTCCGGCGAATGCTCGCTCGCC
CTGGCCGGCGGTGTCACCGTGATGTCCACCCCGGTCGGCTTCGTCGAGTTCGGCGAGATG
GGCGCCCTCTCCCCGGACGGCCGCTGCAAGCCCTTCTCCGACGCCGCCGACGGCACGGCC
TGGTCCGAGGGCGTGGGCATGCTCGTCGTCGAGCGCCTCTCGGAGGCCCGCCGGCGCGGC
CACGAGGTCCTCGCGGTCCTGCGCGGCTCCGCCATCAACCAGGACGGCGCCTCCAACGGT
CTCACCGCCCCCAACGGCCCCTCCCAGCAGCGCGTCATCCGCAAGGCGCTGGCCGCCGCC
GGACTCACCGCCCGCGAGGTCGACGCCGTGGAGGCACACGGGACCGGGACCACCCTCGGT
GACCCCATCGAGGCCCAGGCCCTCCTGGCGACGTACGGGCAGGACCGGCCCGAGGGGCAG
CCGCTGCTGCTCGGCTCGGTCAAGTCCAACATCGGTCACAGCCAGGCCGCCTCCGGCGTC
GCCGGCATCATCAAGATGGTCCTCGCCATGCGGCACGGCACGCTGCCGCGCACCCTGCAC
GCCGAGAAGCCCTCGCGCCACGTCGCCTGGGACCCGGACGCGGTCCACCTGCTGACCGAG
GCGGCCGACTGGCCCGAGACCGGACGCCCGCGCCGCGCCGCTGTCTCCTCCTTCGGCGCC
AGCGGCACCAACGCGCACGTCATCCTGGAACAGGCCCCCACCGGCCCGGCCGCCCCGGAG
CGGGACACGGAGCCCGCCACGCACGCCACCGACGCCGCACGGCTGCTGCCCCTGCCGCTG
TCGGCGGCCACCGCGGACTCCCTGACCGAGCAGGCCGCCCGGCTCCGCGACCGGCTCACC
GCCGGTGCGGCGCAGCCGCCGGCCACCGCCGACCTGGCGCTCTCCCTGGGCACCACCCGC
TCCGCCTTCGAGCACCGGGCCGTCCTCGCCGTGGCCGGCCGCGACGACCTCCTCGACGCG
CTCACCGCCCTCGCCGAGGACCGCGCCCACCCCGCCGTACTGCGCGGCCGCGCGGCCCCC
GGCGGCCGGACCGCGTTCCTCTTCCCCGGGCAGGGCTCCCAGCGCCCCGGGGCGGGCCGC
GCCCTCTACGCCCGCTTCCCGGTCTTCGCCACCGCCCTCGACGAGGTCCTCGCCCACTTC
GACCAGGAACTCGAACGCCCGCTGCGCGACGTGATGTTCGCCGACGAGGGCACCCCCGAG
GCGGCGCTCCTGGACCGGACCGGCTGGACCCAGCCCGCCCTGTTCGCCCTCGGCGTCGCC
CTGTACCGGCTGGTCGAGTCCTGGGGCGTACGGCCCGACCTGCTCGCCGGGCACTCGGTC
GGCGAGCTCGCGGCCGCCCACGTGGCCGGGGTCCTCTCCCTGCCGGACGCCTGCCGCGTC
GTCTCCGCCCGCGCCCGCCTCATGGAGGCACTCCCGGCGGGCGGCGCCATGCTCGCCGTG
CGCGCCACCGAGGACGAGATCGCCCCGTACCTGACCGACCAAATCTGCCTCGCCGCCGTC
AACGGCCCGGAGTCCGTGGTGGTCTCGGGCGACGAGAAGGCGGTCACCGCGCTCGCCGAG
GCCCTCGCCGAACAGGGCCGGAAGACTAGGCGTTTGCGGGTGAGCCATGCGTTTCACTCA
CTGCACATGGACGCCATGCTTCAGGACTTCGAACGGGTCACCCGGAGTGTGTCGTACGCC
CCGCCGACGCTGCCCCTGGTCTCCAACCTCACCGGGGACGCGGCCACCGACGCGCAGGTG
TGCGACCCCGGGTACTGGGTCCGGCACGTCCGCGAGGCGGTCCGCTTCGGCGACGGTGTG
CGCACCCTCGCGGGACGCGGCGCCACCCGCTACCTCGAACTCGGCCCCGACGGAATCCTG
TGCGGCCTCGCCCAGGAGACCCTGGACACCCTCGCCGACGAGAACCGCCCGGCCCCCACG
GCCGTCCCGGCCCTGCGCACCGGACGCGACGAGGAGCAGGCCCTGATCACCGCCGTGGCC
CGGCTGCACGCGGCCGGTCAGGGACTCGACTGGGCGGCACTGCTCGACGGCACCGGCGCC
CGCCGCGTCGACCTGCCCACCTACCCGTTCCGCCGACTGCGGTTCTGGCCCGACGAGGCA
CCCGCCGCCGCCACCGGCACCACGGCCGACGCCGGGGACGCCGCCTTCTGGGCGGCGGTC
CAGGACGAGCAGTTCGACTCCCTCGCCGGGGAACTCGGCGTCGACGGCGACGCGTTGCTG
CGCGTCCTGCCGGCCCTGCGGGACTGGCGCCGCAAGCACGGCGACCAGACCACCGTGGAC
GGCTGGCGCCAGCGCATCGCCTGGCGGCCCCTGAACCGGGCCACCGCCGGCACCCCCGCC
GGCACCTGGCTCGCCGTCGTGCCCGCCGACCACGCCGACCATCCGTGGACCTCCGCCGTC
CTGGCCGCGCTCGGCGCGGGCGCCCAGGTCCTGGAGGTCTCCGGCAAGGACCGCGCCGGA
CTCGCCGCCGCGATCCGCGAACGGCTCGACGCCACCGGGCCGTTCACCGGTGTGGTCTCC
CTGCTCGCCGTCGCCGGGGAACCCGGTGACGGGACCGGCGCCCTCCCCGGCGGCGTCCCG
GCCGGCGCGGCCCTGACCGCGACCCTGGTCCAGGCGCTCGGCGACGCCCGCACCGACGCC
CCGCTGTGGTGCCTCACCCGTGGCGCCGCCGCCGTCTCGCCCGCCGAGACCGTCGCCGCA
CCGCTCCAGGCCGCCGTCCACGGACTCGGCCGGGTCGCCGCGCTGGAGCACCCGCAGCGC
TGGGGCGGCACCGTCGATCTGCCGCTCGCTGTCGACGCGCGGACCGCCGAACGGCTCGCC
GCCGTCCTCGCCGACCCCGAGGGCGAGGACCAGCTCGCCGTCCGGCCCGGTGCGGTCTTC
GGCCGCCGCCTCGCCGCCGTCCGGCCCGGGACGCCCCGCGACTGGAAGCCCACCGGAACC
GTCCTGATCACCGGCGGCACCGGCGCCCTCGGTGCCCGTACCGCCCGCCGCCTGGCCGGT
GCCGGAGCCCGCCGCCTGGTCCTCCTCAGCCGCAGCGGACCCGACGCGCCCGGCGCCGGC
GAACTCGCCGCCGACCTGCGCGCGCTCGGCGCCGAACCCGTCATCACCGCCTGCGACACC
GCCGACCGGAAGGCGCTGGCCGCCGTCCTCGCGGCGATCCCCGAGGACGCGCCGCTCACC
GGCGTCATCCACACCGCCGGAGTGCTGGACGACGGCGTCGTGGACGGCCTGACCCCCGAG
CGGTTCGCCACGGTGTTCCGGGCCAAGGTGGCCTCCGCGCTGCTCCTGGACGAACTGACC
CGCGCCCACGACCTGGAGGTGTTCGCCCTCTTCTCCTCGGCGTCCGCCGCCGTCGGCAAC
CCGGGCCAGGGCACCTACGCCGCCGCCAACGCGGTCCTCGACGCCCTCGCCGAACAGCGC
AGGGCCGAGGGGCTGCCCGCCACCTCCGTGGCGTACGGCGCCTGGGGCGGGGAGGGCATG
GCCGACGGCGTCCGCGCCGCCGCGCTCGCCCGCCGCACCGGCATCCGGCCGCTCGACCCG
GACCTCGCGGTCCTCGCGCTGCGGCAAGTCGTCACGGGCAGCGACCCGGTCGCCGTCGTC
GCCGACGTCGACCCCGACCGGTTCGTCCGCGCGTTCACCACCGTCCGGCCCAGCAGCCTG
CTGGCCGAGATGCCCGCGTACGCCGCCCTCAAGAAGGCCGCATCCGCCGGCGGCGAGGCC
GCGGACTCCGGTCCCTCGCTGCGCGACCGGCTGGCCAGGCTGCCCGAGAGCCGCCGTACC
CAGACGGTCCTGACGCTGGTGCGCGAACGCGCCGCGGAGGTCCTCGGCCTCACCGGAACC
GACCAGGTGGGCCCCGACCGGGCCTTCCGCGACCTCGGATTCGACTCCCTCGGCGCCGTC
GAGCTGCGCAACCAGCTCGGCGCCGTCAGCGGACTCACCCTGTCCGCGACCCTCGTGTTC
GACCACCCCACGCCCGCCGCACTCGCCGCCCACATCCTCGGACAACTCCTCCCGGCCGGC
ACCCCCGGTGCCCCCGCCACGGACGGAGCCGGCGAAGAGGAGCGGGCCGTGCGCGCCGCC
CTCGCCCAGGTCCCCCTGGACCGGCTGCGCGACAGCGGACTCCTGGACCAGCTGCTGGAC
CTCGCCGGGCAGGACCCGGCCGGAACAGGCACGGACCAGGAGGCCGAGCCCTCCGGGGCC
GGCGACGCCTACGACGCGTCGATCGACGCCATGGACGTCGACGGCCTGGTGCAGGCGGCA
CTCAACGGTAACCCTGACGAAGAGCGGGACTGA
[11] KS39..404
[11] AT563..884
[11] malonyl-CoA755..759
[11] DH933..1096
[11] KR1410..1590
[11] ACP1692..1762
[12] KS1786..2159
[12] AT2316..2644
[12] malonyl-CoA2516..2520
[12] KR2972..3151
[12] ACP3244..3322
[13] KS3342..3715
[13] AT3873..4190
[13] methylmalonyl-CoA not conserved YASHS(S->T)4065..4069
[13] KR4499..4679
[13] ACP4780..4850
[14] KS4872..5248
[14] AT5410..5738
[14] malonyl-CoA5603..5607
[14] KR6049..6228
[14] ACP6329..6399
[15] KS6426..6796
[15] AT6938..7258
[15] malonyl-CoA7127..7131
[15] kr7559..7728
[15] ACP7836..7906
[16] KS7931..8301
[16] AT8466..8786
[16] malonyl-CoA8656..8660
[16] KR9099..9278
[16] ACP9383..9453
[11] KS115..1212
[11] AT1687..2652
[11] malonyl-CoA2263..2277
[11] DH2797..3288
[11] KR4228..4770
[11] ACP5074..5286
[12] KS5356..6477
[12] AT6946..7932
[12] malonyl-CoA7546..7560
[12] KR8914..9453
[12] ACP9730..9966
[13] KS10024..11145
[13] AT11617..12570
[13] methylmalonyl-CoA not conserved YASHS(S->T)12193..12207
[13] KR13495..14037
[13] ACP14338..14550
[14] KS14614..15744
[14] AT16228..17214
[14] malonyl-CoA16807..16821
[14] KR18145..18684
[14] ACP18985..19197
[15] KS19276..20388
[15] AT20812..21774
[15] malonyl-CoA21379..21393
[15] kr22675..23184
[15] ACP23506..23718
[16] KS23791..24903
[16] AT25396..26358
[16] malonyl-CoA25966..25980
[16] KR27295..27834
[16] ACP28147..28359

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [555-687]  G3DSA:3.40.366.10 [755-873]  G3DSA:3.40.366.10 [2309-2448]  G3DSA:3.40.366.10 [2516-2633]  G3DSA:3.40.366.10 [3865-3996]  G3DSA:3.40.366.10 [4065-4182]  G3DSA:3.40.366.10 [5408-5532]  G3DSA:3.40.366.10 [5602-5719]  G3DSA:3.40.366.10 [6931-7062]  G3DSA:3.40.366.10 [7127-7247]  G3DSA:3.40.366.10 [8457-8591]  G3DSA:3.40.366.10 [8656-8778]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1410-1577]  5.19999999999996e-61 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1720-1735]  PS00012 [3280-3295]  PS00012 [4808-4823]  PS00012 [6357-6372]  PS00012 [7864-7879]  PS00012 [9411-9426]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1690-1767]  3.49999999999995e-126 G3DSA:1.10.1200.10 [3252-3325]  3.49999999999995e-126 G3DSA:1.10.1200.10 [4783-4880]  9.00000000000011e-110 G3DSA:1.10.1200.10 [6329-6402]  3.49999999999995e-126 G3DSA:1.10.1200.10 [7835-7909]  3.49999999999995e-126 G3DSA:1.10.1200.10 [9381-9456]  3.49999999999995e-126 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1685-1802]  3.80000697093586e-30 SSF47336 [3245-3359]  6.90001478563507e-25 SSF47336 [4773-4889]  6.50000805230168e-23 SSF47336 [6322-6442]  2.70000183580794e-27 SSF47336 [7829-7947]  1.50000306971104e-27 SSF47336 [9375-9470]  2.30000440726534e-23 SSF47336
SSF47336   ACP_like
 [1692-1762]  PS50075 [3244-3322]  PS50075 [4780-4850]  PS50075 [6329-6399]  PS50075 [7836-7906]  PS50075 [9383-9453]  PS50075
PS50075   ACP_DOMAIN
 [1696-1761]  1.6e-11 PF00550 [3255-3321]  2.5e-07 PF00550 [4783-4849]  2.2e-07 PF00550 [6332-6398]  1.1e-13 PF00550 [7839-7905]  4.9e-11 PF00550 [9387-9452]  4.40000000000001e-13 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [2972-3151]  4.2e-64 PF08659 [4499-4678]  9.9e-58 PF08659 [6049-6227]  6.59999999999996e-63 PF08659 [7559-7727]  3.39999999999999e-28 PF08659 [9099-9277]  1.29999999999998e-58 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [39-278]  6.20000000000009e-84 PF00109 [1786-2034]  6.20000000000009e-95 PF00109 [3342-3590]  8.39999999999977e-96 PF00109 [4872-5122]  7.30000000000007e-96 PF00109 [6426-6670]  3.49999999999995e-89 PF00109 [7931-8176]  3.39999999999996e-88 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [286-404]  3.40000000000004e-45 PF02801 [2042-2159]  1.29999999999998e-47 PF02801 [3598-3715]  8.00000000000001e-47 PF02801 [5130-5248]  4.6e-48 PF02801 [6678-6796]  6.40000000000004e-45 PF02801 [8184-8301]  3.29999999999997e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [563-884]  2.59999999999995e-66 PF00698 [2316-2644]  3.60000000000002e-56 PF00698 [3873-4190]  3.79999999999991e-108 PF00698 [5410-5738]  1.9e-69 PF00698 [6938-7258]  7.90000000000016e-67 PF00698 [8466-8786]  4.39999999999996e-62 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [6-32]  1e-08 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [559-865]  1.09999184471405e-70 SSF52151 [2312-2638]  1.79999754022375e-64 SSF52151 [3871-4174]  2.59998233910302e-67 SSF52151 [5407-5702]  2.99998750445706e-69 SSF52151 [6934-7221]  2.99998750445706e-72 SSF52151 [8463-8766]  2.80000504261099e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [689-754]  4.00000300869883e-18 SSF55048 [2450-2515]  2.79999889404114e-16 SSF55048 [3999-4064]  4.19999771339581e-18 SSF55048 [5537-5602]  2.30000440726534e-18 SSF55048 [7064-7126]  1.09999909120787e-15 SSF55048 [8593-8655]  9.19998414420358e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [41-290]  G3DSA:3.40.47.10 [291-458]  G3DSA:3.40.47.10 [1788-2046]  G3DSA:3.40.47.10 [2047-2210]  G3DSA:3.40.47.10 [3345-3602]  G3DSA:3.40.47.10 [3603-3767]  G3DSA:3.40.47.10 [4881-5134]  G3DSA:3.40.47.10 [5135-5301]  G3DSA:3.40.47.10 [6426-6680]  G3DSA:3.40.47.10 [6682-6847]  G3DSA:3.40.47.10 [7930-8186]  G3DSA:3.40.47.10 [8188-8353]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [31-402]  1.09999184471405e-94 SSF53901 [1778-2158]  1.90000694315261e-103 SSF53901 [3335-3714]  4.69998262513189e-104 SSF53901 [4865-5246]  1.09999184471405e-102 SSF53901 [6418-6794]  3.89999861795218e-103 SSF53901 [7923-8354]  1.59998835313644e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1410-1599]  G3DSA:3.40.50.720 [2972-3157]  G3DSA:3.40.50.720 [4499-4685]  G3DSA:3.40.50.720 [6049-6234]  G3DSA:3.40.50.720 [7556-7738]  G3DSA:3.40.50.720 [9099-9312]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [191-207]  PS00606 [1947-1963]  PS00606 [3503-3519]  PS00606 [5035-5051]  PS00606 [6583-6599]  PS00606 [8089-8105]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [563-865]  3.89999861795218e-125 SM00827 [2316-2624]  1.50000965748778e-113 SM00827 [3875-4173]  3.79997359309399e-125 SM00827 [5411-5718]  6.70008515263412e-130 SM00827 [6938-7238]  5.6999970878395e-127 SM00827 [8467-8769]  5.6999970878395e-125 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1693-1765]  1.40000506907309e-33 SM00823 [3253-3325]  1.50000306971104e-29 SM00823 [4781-4853]  4.09999599045784e-27 SM00823 [6330-6402]  9.60004130884281e-36 SM00823 [7837-7909]  2.19999900980707e-34 SM00823 [9384-9456]  2.30000440726534e-32 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [933-1096]  2.39999798157263e-90 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [41-457]  SM00825 [1788-2212]  SM00825 [3345-3768]  SM00825 [4875-5300]  SM00825 [6428-6848]  SM00825 [7933-8354]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1410-1590]  9.19998414420354e-59 SM00822 [2972-3151]  1.79999754022375e-59 SM00822 [4499-4679]  5.6999970878395e-54 SM00822 [6049-6228]  5.79999653854781e-58 SM00822 [7559-7728]  1.29999924468179e-12 SM00822 [9099-9278]  4.60000044330862e-55 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit