close all open/close all
FR008_00200 FR008_00200   last last

CDS information : FR008_00210


close this sectionLocation

Organism
StrainFR-008
Entry nameFR-008
Contig
Start / Stop / Direction137,592 / 136,558 / - [in whole cluster]
137,592 / 136,558 / - [in contig]
Locationcomplement(136558..137592) [in whole cluster]
complement(136558..137592) [in contig]
TypeCDS
Length1,035 bp (344 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative GDP-mannose 4,6-dehydratase
putative GDP-D-mannose dehydratase
Product (GenBank)FscMIII
GenefscMIII
gmd
Gene (GenBank)fscMIII
EC number4.2.1.47
Keyword
  • mycosamine
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • putative GDP-mannose-4, 6-dehydratase responsible for mycosamine biosynthesis
Reference
ACC
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
Related Reference
ACC
Q9L4X4
NITE
Nysta_00040
PmId
[17905880] Analysis of the mycosamine biosynthesis and attachment genes in the nystatin biosynthetic gene cluster of Streptomyces noursei ATCC 11455. (Appl Environ Microbiol. , 2007)

close this sectionSequence

selected fasta
>putative GDP-mannose 4,6-dehydratase [FscMIII]
MSKRALITGITGQDGSYLAEHLLDQGYQVWGLCRGQANPRKDRIAKLIPELSFVDGDLMD
QGSLVSAVDLVQPDEVYNLGAISFVPMSWQQPELVTEVNGTGVLRMLEAVRIVSGLTKSS
GGSPRGQIRFYQASSSEMYGKVAESPQRETTSFHPRSPYGVAKAFGHYITQNYRESYGMY
GVSGILFNHESPRRGAEFVTRKISLAVAQIKLGQMDKLHLGNLDAERDWGFAGDYVRAMH
LMLQQEQAGDYVVGTGAMHQVRDAARIAFEHVGLDWQEHVVVDPGLVRPAEVETLCADSG
NARRELGWEPEVDFEQLMRMMVESDLRQASRERDYSQLLATGSW
selected fasta
>putative GDP-mannose 4,6-dehydratase [FscMIII]
ATGTCCAAGCGTGCACTCATCACCGGAATCACCGGACAGGACGGTTCGTACCTGGCCGAA
CACCTCCTCGACCAGGGGTACCAGGTCTGGGGGCTCTGCCGGGGTCAGGCCAACCCCCGC
AAGGACCGGATCGCCAAGCTGATCCCGGAGCTGTCCTTCGTGGACGGCGACCTCATGGAC
CAGGGCAGCCTGGTCTCGGCGGTCGACCTGGTCCAGCCCGACGAGGTCTACAACCTGGGC
GCCATCTCCTTCGTGCCGATGTCCTGGCAACAGCCCGAACTGGTCACGGAGGTCAACGGC
ACCGGCGTGCTGCGCATGCTGGAGGCGGTCCGCATCGTCTCCGGCCTCACCAAGTCCTCC
GGCGGCTCGCCCCGCGGCCAGATCCGCTTCTACCAGGCGTCCTCCTCCGAGATGTACGGC
AAGGTGGCGGAGAGCCCGCAGCGGGAGACCACCTCCTTCCACCCCCGCAGCCCGTACGGC
GTGGCCAAGGCCTTCGGCCACTACATCACCCAGAACTACCGCGAGTCGTACGGGATGTAC
GGGGTCTCCGGGATCCTGTTCAACCACGAGTCGCCGCGCCGTGGCGCCGAGTTCGTCACC
CGCAAGATCTCGCTGGCCGTCGCCCAGATCAAACTGGGCCAGATGGACAAGCTGCACCTC
GGCAACCTCGACGCCGAGCGCGACTGGGGCTTCGCGGGTGACTACGTCCGCGCCATGCAC
CTGATGCTCCAGCAGGAGCAGGCCGGTGACTACGTGGTGGGGACCGGAGCCATGCACCAG
GTCCGCGACGCGGCCCGGATCGCCTTCGAGCACGTCGGCCTCGACTGGCAGGAGCACGTC
GTCGTCGACCCCGGCCTGGTGCGCCCCGCCGAGGTCGAGACCCTCTGCGCCGACTCGGGC
AACGCCCGGCGCGAACTGGGCTGGGAGCCCGAGGTCGACTTCGAGCAGCTGATGCGCATG
ATGGTCGAGTCCGACCTGCGCCAGGCATCGCGGGAGCGGGACTACAGCCAGCTCCTGGCC
ACCGGCAGCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [5-254]  8.00000000000001e-62 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [2-192]  1.5e-45 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit
FR008_00200 FR008_00200   last last