close all open/close all
first first   Fred_00020 Fred_00020

CDS information : Fred_00010


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction1,631 / 33 / - [in whole cluster]
1,631 / 33 / - [in contig]
Locationcomplement(33..1631) [in whole cluster]
complement(33..1631) [in contig]
TypeCDS
Length1,599 bp (532 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl-CoA carboxylase beta subunit
Product (GenBank)putative acyl CoA decarboxylase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in fredericamycins biosynthesis.
Note (GenBank)
  • Orf1
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
Related Reference
ACC
O86517
PmId
[11526020] Role of an essential acyl coenzyme A carboxylase in the primary and secondary metabolism of Streptomyces coelicolor A3(2). (Appl Environ Microbiol. , 2001)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)
ACC
O54028
PmId
[9428714] Methylmalonyl-CoA decarboxylase from Propionigenium modestum--cloning and sequencing of the structural genes and purification of the enzyme complex. (Eur J Biochem. , 1997)
ACC
Q9X4K7
PmId
[10589718] Genetic and biochemical characterization of the alpha and beta components of a propionyl-CoA carboxylase complex of Streptomyces coelicolor A3(2). (Microbiology. , 1999)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)

close this sectionSequence

selected fasta
>putative acyl-CoA carboxylase beta subunit [putative acyl CoA decarboxylase]
MSVVEESPLNSAAPADGHLRDRAAELAALHERVRRGPGERATEAQHAKGKLTVRERLALL
FDEGTFTEIEELRRHRATGFGLEQRRPHTDGVVTGWGEVDGRTVFAYAHDFRIFGGALGE
AHAEKIHKLLDLAESAGRPVVGLCDGAGARIQEGVTALAGYGGIFARNVRNSGVIPQISV
ILGPCAGGAAYSPALTDFVFMVRGTSQMFITGPDVVQAVTGEVITHDALGGADAHASVSG
VAHAAYDDEESCLADVRHLLSLLPSNNRELPPAAPGADPASRRTEALLDLVPADPGRAYD
MRAVITEIVDDGEVFEIQESWATNIVCVIARLDGQAVGIVANQPAAFAGVLDIHASEKAA
RFVQTCDAFNLPLVTLVDVPGFLPGVDQEHGGIIRHGAKLLYAYCNATVPRVQLILRKAY
GGAYIVMDSRSIGADVSLAWPGNEIAVMGAEGAAGVVFRREIAAADDPEATRARLVKEYR
AELMHPYYAAERGLVDSVIDPAETRSRLIGALTMLRAKHAPLPTRKHGNQPQ
selected fasta
>putative acyl-CoA carboxylase beta subunit [putative acyl CoA decarboxylase]
ATGAGCGTCGTCGAGGAATCGCCCCTGAACTCCGCGGCACCGGCCGACGGCCACCTGCGC
GACCGCGCCGCCGAACTCGCCGCACTGCACGAGCGCGTGCGGCGCGGCCCCGGCGAGCGC
GCCACCGAGGCGCAGCACGCCAAGGGAAAACTGACCGTGCGCGAACGGCTGGCGCTCCTC
TTCGACGAGGGCACCTTCACGGAGATCGAGGAGTTGCGCCGGCACCGGGCCACCGGATTC
GGCCTGGAGCAACGGCGGCCCCACACCGACGGGGTGGTCACTGGCTGGGGAGAGGTCGAC
GGGCGCACGGTCTTCGCCTACGCCCACGACTTCCGGATCTTCGGCGGGGCGCTCGGCGAG
GCACACGCGGAGAAGATCCACAAACTGCTGGACCTCGCCGAGTCCGCCGGCCGCCCGGTG
GTCGGCCTCTGCGACGGCGCGGGTGCCCGCATTCAGGAGGGCGTGACGGCCCTCGCCGGC
TACGGCGGCATCTTCGCCCGGAACGTGCGCAACTCCGGGGTCATCCCGCAGATCAGCGTG
ATCCTCGGGCCGTGCGCGGGCGGCGCCGCCTACTCCCCGGCGCTGACGGACTTCGTCTTC
ATGGTGCGCGGCACCTCCCAGATGTTCATCACCGGCCCGGACGTGGTGCAGGCCGTCACC
GGCGAGGTCATCACCCACGACGCGCTCGGGGGCGCCGACGCCCACGCGTCCGTCTCGGGT
GTCGCCCACGCCGCCTACGACGATGAGGAGAGCTGCCTGGCGGACGTCCGCCACCTGCTC
TCCCTGCTGCCCTCGAACAACCGGGAACTACCGCCCGCCGCGCCCGGCGCGGACCCGGCG
AGCCGCCGGACCGAGGCGCTGCTGGACCTGGTGCCGGCCGATCCGGGCCGGGCCTACGAC
ATGCGCGCGGTGATCACGGAGATCGTCGACGACGGTGAGGTCTTCGAGATCCAGGAGTCC
TGGGCCACCAACATCGTCTGTGTCATCGCCCGGCTCGACGGACAGGCCGTCGGCATCGTC
GCCAACCAGCCCGCCGCCTTCGCCGGGGTCCTCGACATCCACGCGTCCGAGAAGGCCGCA
CGCTTCGTCCAGACCTGCGACGCCTTCAACCTGCCCCTGGTGACCCTGGTCGACGTGCCC
GGCTTCCTGCCCGGCGTCGACCAGGAACACGGCGGCATCATCCGGCACGGCGCGAAACTG
CTCTACGCGTACTGCAACGCGACCGTTCCCCGGGTGCAGCTCATCCTGCGCAAGGCCTAC
GGCGGCGCGTACATCGTGATGGACTCCCGCTCCATCGGAGCGGACGTCTCGCTGGCCTGG
CCGGGCAACGAGATCGCGGTGATGGGGGCGGAGGGAGCGGCCGGCGTGGTCTTCCGCCGG
GAGATCGCCGCGGCCGACGACCCCGAGGCGACGCGGGCCCGTCTGGTCAAGGAGTACCGG
GCCGAGCTGATGCATCCTTACTACGCGGCCGAGCGCGGCCTCGTCGACAGCGTGATCGAT
CCGGCGGAGACCCGGAGCCGCCTCATCGGGGCGCTGACCATGCTCCGGGCCAAGCACGCC
CCGCTCCCCACCCGCAAGCACGGGAACCAGCCCCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000022 Carboxyl transferase (Domain)
 [44-529]  PF01039
PF01039   Carboxyl_trans
IPR011762 Acetyl-coenzyme A carboxyltransferase, N-terminal (Domain)
 [25-239]  PS50980
PS50980   COA_CT_NTER
IPR011763 Acetyl-coenzyme A carboxyltransferase, C-terminal (Domain)
 [240-524]  PS50989
PS50989   COA_CT_CTER
SignalP
 [1-23]  0.036 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
first first   Fred_00020 Fred_00020