close all open/close all

CDS information : Fred_00020


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction1,727 / 2,770 / + [in whole cluster]
1,727 / 2,770 / + [in contig]
Location1727..2770 [in whole cluster]
1727..2770 [in contig]
TypeCDS
Length1,044 bp (347 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative acyl-ACP thioesterase
Product (GenBank)putative acyl transferase
Gene
Gene (GenBank)
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • Orf2
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
Related Reference
ACC
Q9KHK3
NITE
Enter_00120
PmId
[21531566] Policing starter unit selection of the enterocin type II polyketide synthase by the type II thioesterase EncL. (Bioorg Med Chem. , 2011)
ACC
Q9F6D9
NITE
R1128_00030
PmId
[15260498] The acyltransferase homologue from the initiation module of the R1128 polyketide synthase is an acyl-ACP thioesterase that edits acetyl primer units. (Biochemistry. , 2004)

close this sectionSequence

selected fasta
>putative acyl-ACP thioesterase [putative acyl transferase]
MTRPTQRSVVLMFPGTGAQHPRMAAGLYRREPVFTAAVDAVLGELGAEGEAVRADWLADV
PAVPLEADARSAPLLFAVDYAVGRLVESWGVRPAAYVGHSMGEFAAATLAGVFRLEDAVR
LLWDRVEKQRATPVGGMTAVAAARHEVAGYLGAGVVVGAVNGPRHTVLSGPEAPLRAVEE
RLASDGRTFRRLATRTPYHSPALAPLVPGGAALVAGMPLSAPRTLLYSAYTAGPLREREA
LAPAFWAAQPTAPVLFWQTLDRVLRDDDRLLVEAGPSHSLSVLARSHPAVRSGRSTVATT
LPPRAQGPRADRLSLRALRAWLSAEGALPVPPGPGHSGTLPVELPLS
selected fasta
>putative acyl-ACP thioesterase [putative acyl transferase]
ATGACGCGTCCGACGCAGCGCTCCGTCGTCCTGATGTTCCCGGGCACCGGGGCCCAGCAC
CCGCGGATGGCGGCTGGTCTCTACCGGCGGGAGCCGGTCTTCACGGCCGCCGTCGACGCG
GTTCTGGGTGAGCTGGGCGCCGAGGGCGAGGCGGTACGTGCCGACTGGCTGGCCGACGTG
CCCGCCGTGCCGCTGGAGGCCGACGCCCGGTCGGCGCCCCTGCTGTTCGCCGTGGACTAC
GCCGTGGGGCGGCTGGTGGAGAGCTGGGGGGTGCGGCCCGCGGCGTACGTGGGGCACAGC
ATGGGGGAGTTCGCCGCCGCGACGCTCGCGGGGGTGTTCCGGCTGGAGGACGCCGTGCGG
CTGCTGTGGGACCGGGTGGAGAAGCAGCGCGCGACCCCGGTAGGCGGCATGACCGCGGTG
GCGGCGGCGCGGCACGAGGTGGCGGGATACCTGGGGGCGGGTGTGGTCGTGGGCGCGGTC
AACGGCCCCCGGCACACGGTGCTGTCCGGCCCCGAGGCGCCGCTGCGCGCGGTCGAGGAG
CGGCTCGCCTCGGACGGCAGGACGTTCCGGCGGCTCGCCACCCGCACCCCGTACCACAGC
CCCGCGCTGGCGCCGCTCGTCCCCGGCGGGGCCGCCCTCGTCGCCGGCATGCCGCTCTCC
GCTCCCCGCACCCTTCTCTACTCCGCCTACACCGCCGGGCCGTTGCGCGAACGGGAGGCG
CTGGCCCCCGCCTTCTGGGCGGCCCAGCCGACGGCCCCGGTGCTGTTCTGGCAGACGCTG
GACCGGGTGCTGCGCGACGACGACCGGCTGCTGGTCGAGGCCGGGCCCTCGCACAGCCTC
TCGGTTCTGGCCAGGAGCCATCCGGCGGTGCGCTCCGGGCGCAGCACGGTGGCGACCACG
CTGCCTCCCCGGGCGCAGGGGCCCCGGGCGGACCGGCTCAGCCTCCGCGCGCTCCGTGCG
TGGTTGAGCGCGGAGGGGGCGCTGCCGGTCCCTCCGGGGCCGGGTCACTCCGGAACGTTG
CCGGTGGAGCTCCCGCTCTCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [5-132]  1.5e-47 G3DSA:3.40.366.10 [196-289]  1.5e-47 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014043 Acyl transferase (Domain)
 [10-287]  4.10000000000004e-38 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [8-288]  3.70001063537244e-40 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [133-195]  3.1999989904635e-11 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
SignalP
 [1-24]  0.858 Signal
Bacteria, Gram-negative   
 [1-18]  0.2 Signal
Eukaryota   
 [1-24]  0.241 Signal
Bacteria, Gram-positive   
TMHMM No significant hit