close all open/close all

CDS information : Fred_00040


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction4,971 / 5,771 / + [in whole cluster]
4,971 / 5,771 / + [in contig]
Location4971..5771 [in whole cluster]
4971..5771 [in contig]
TypeCDS
Length801 bp (266 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productketoreductase
Product (GenBank)putative 3-ketoacyl-ACP reductase
GenefdmC
Gene (GenBank)
EC number
Keyword
  • hexadienyl unit
Note
Note (GenBank)
  • FdmC
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
[18556785] Identification and utility of FdmR1 as a Streptomyces antibiotic regulatory protein activator for fredericamycin production in Streptomyces griseus ATCC 49344 and heterologous hosts. (J Bacteriol. , 2008)
[20540492] Mechanism and engineering of polyketide chain initiation in fredericamycin biosynthesis. (J Am Chem Soc. , 2010)

close this sectionSequence

selected fasta
>ketoreductase [putative 3-ketoacyl-ACP reductase]
MLTPGRSGSPGRVGHGREHAMELRRSALVTGGSRGIGRAVAVRLAQDGYDIGFCSRSADE
AALETARLVTSAGARAHHVVCDVTDADAVRTFVAEAEEKLGPAYAVVNSAGVLRDRPMAL
MAARDWQDVVGTSLDGAFHVCRAVVRGLLTRRAGALVNVSSVIGVYGNAGQTNYAAAKGG
LNGLTRALAKEVAPYGVRVNAVAPGFIETEMLDGMTAKAREAALGKIAMARFGSAESVAA
LVAFLVSDAADYITGQVVQIDGGIAL
selected fasta
>ketoreductase [putative 3-ketoacyl-ACP reductase]
ATGCTCACGCCCGGCCGGAGCGGCTCGCCCGGCCGAGTCGGGCACGGGAGGGAGCACGCG
ATGGAGCTGAGGCGCAGTGCGCTGGTGACGGGTGGTTCGCGCGGCATCGGCCGCGCGGTC
GCGGTACGGCTGGCACAGGACGGGTACGACATCGGCTTCTGCTCGCGTTCCGCCGACGAG
GCGGCGCTGGAGACGGCCCGGCTGGTCACCTCGGCCGGTGCTCGGGCGCACCACGTGGTG
TGCGACGTCACCGACGCCGACGCCGTTCGGACCTTCGTCGCGGAGGCGGAGGAGAAGCTC
GGCCCGGCGTACGCGGTGGTCAACTCCGCGGGGGTGCTGCGGGACCGGCCGATGGCCCTG
ATGGCGGCCAGGGACTGGCAGGACGTGGTCGGTACGAGTCTGGACGGGGCCTTCCACGTC
TGCCGGGCGGTCGTGCGCGGGCTGCTCACCCGCAGGGCGGGGGCGCTGGTGAACGTCTCC
TCGGTCATCGGGGTGTACGGCAACGCGGGACAGACCAACTACGCCGCCGCCAAGGGCGGA
CTGAACGGCCTGACCCGTGCCCTGGCCAAGGAGGTCGCCCCGTACGGCGTCCGGGTCAAC
GCGGTGGCGCCCGGGTTCATCGAGACGGAGATGCTCGACGGCATGACGGCCAAGGCGCGC
GAGGCGGCCCTCGGGAAGATCGCCATGGCGCGGTTCGGCAGCGCCGAGTCCGTCGCCGCG
CTCGTCGCGTTCCTCGTCTCCGACGCCGCCGACTACATCACCGGCCAGGTGGTGCAGATC
GACGGCGGGATCGCCCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [26-192]  3.40000000000004e-42 PF00106
PF00106   adh_short
 [101-112]  2.79999889404114e-10 PR00080 [154-162]  2.79999889404114e-10 PR00080 [174-193]  2.79999889404114e-10 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [26-43]  2.1000026783403e-41 PR00081 [101-112]  2.1000026783403e-41 PR00081 [148-164]  2.1000026783403e-41 PR00081 [174-193]  2.1000026783403e-41 PR00081 [195-212]  2.1000026783403e-41 PR00081 [228-248]  2.1000026783403e-41 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [25-265]  2.79999999999994e-79 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [161-189]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit