close all open/close all

CDS information : Fred_00050


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction5,782 / 7,263 / + [in whole cluster]
5,782 / 7,263 / + [in contig]
Location5782..7263 [in whole cluster]
5782..7263 [in contig]
TypeCDS
Length1,482 bp (493 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative peptide transporter
Product (GenBank)putative peptide transporter
GenefdmT
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • FdmT
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
Related Reference
ACC
P0C2U3
PmId
[8157671] The di- and tripeptide transport protein of Lactococcus lactis. A new type of bacterial peptide transporter. (J Biol Chem. , 1994)

close this sectionSequence

selected fasta
>putative peptide transporter [putative peptide transporter]
MTLDEGTSADSVTRTDPERPLRSMFRERWFSTLFMTDMWERFSFYGMQALLFLYATAPVA
EDGLGLTAGTAGALFGLYVSGSFLAAMPGGWLGDRVLGTHRAMLCGALVIMAGHLSMAVP
AQATFYLGLVLVACGTGLLKPNLPVMFDQMNPGASSSRRQAAFSLFYMSIQVSALVGPLV
TGILGERVNWHLGFGAAAVGMAFGVLQYLHGAPSLRGAATGPSRPLPPAALRRLVRRCWA
ALAGAVLLGAGLALSGGLPLRPVLALCGLASLVAPVWYFRRLLRDRSLGEAERARVRGYV
RVFVPSVLFWAMFGQVGSVFSLFAREHTDREVAGFSVPASWFQSAHPLFLLLLAPVFAWL
WLRIGARAGVARKFSVGLLCAGGGFAFLAVGAWLASGGRAVVSPLWLLAAFLCMTCGELV
FGPVGLSTTAESTPAGHGSRMMGLFYLGAALGAGVGGQLSHLVGVVPLWSYLAGFVVAAV
ATALLLPRRTAEI
selected fasta
>putative peptide transporter [putative peptide transporter]
ATGACTCTCGACGAGGGGACGTCCGCGGACTCCGTCACCCGGACCGACCCGGAGCGGCCG
CTCCGGTCGATGTTCCGTGAGCGCTGGTTCTCCACCCTCTTCATGACCGACATGTGGGAG
CGGTTCAGCTTCTACGGCATGCAGGCGCTGCTCTTCCTCTACGCCACGGCGCCGGTCGCC
GAGGACGGACTGGGCCTGACCGCCGGTACCGCGGGAGCCCTGTTCGGCCTCTACGTGTCG
GGTTCGTTCCTGGCGGCCATGCCGGGCGGCTGGCTGGGCGACCGGGTGCTGGGCACGCAC
CGGGCCATGCTCTGCGGTGCCCTGGTCATCATGGCCGGGCACCTGTCCATGGCCGTTCCG
GCCCAGGCCACCTTCTACCTCGGCCTGGTCCTGGTGGCCTGCGGCACCGGGCTGCTGAAG
CCCAATCTGCCGGTCATGTTCGACCAGATGAACCCCGGCGCGTCCAGCAGCCGGCGGCAG
GCGGCGTTCTCGCTCTTCTACATGAGTATCCAGGTGAGCGCCCTGGTGGGGCCGCTGGTC
ACGGGGATCCTCGGGGAACGGGTCAACTGGCACCTGGGGTTCGGCGCGGCCGCCGTGGGC
ATGGCCTTCGGGGTGCTCCAGTACCTGCACGGGGCACCGTCGCTGCGCGGAGCGGCGACG
GGCCCCAGCAGGCCCCTGCCGCCCGCCGCTCTGCGCCGCCTGGTCCGCCGGTGCTGGGCG
GCCCTGGCCGGCGCCGTGCTGCTGGGGGCGGGACTGGCACTCTCGGGGGGTCTGCCGCTG
CGTCCGGTCCTGGCCTTGTGCGGGCTGGCCTCCCTGGTGGCGCCCGTCTGGTACTTCCGG
CGGCTGCTGCGGGACCGGTCGCTGGGCGAGGCCGAACGGGCGCGGGTGCGCGGCTACGTG
CGCGTCTTCGTGCCGTCGGTACTGTTCTGGGCGATGTTCGGGCAGGTGGGCTCGGTCTTC
AGCCTGTTCGCCCGGGAGCACACCGATCGCGAGGTGGCCGGATTCAGCGTGCCGGCGAGC
TGGTTCCAGTCGGCGCATCCGCTCTTCCTGCTGTTGTTGGCACCGGTGTTCGCCTGGCTC
TGGCTGAGGATCGGGGCGCGTGCGGGGGTGGCGCGGAAATTCTCCGTGGGGCTGCTCTGC
GCGGGCGGCGGCTTCGCCTTCCTCGCCGTCGGCGCCTGGCTCGCCTCCGGCGGGCGGGCG
GTGGTGTCCCCGTTGTGGCTGCTGGCCGCCTTCCTCTGCATGACCTGCGGTGAGCTGGTC
TTCGGGCCGGTCGGACTGAGTACCACCGCCGAGTCGACCCCCGCAGGCCACGGCAGCCGG
ATGATGGGGCTCTTCTACCTCGGGGCGGCGCTGGGCGCCGGTGTCGGCGGGCAGCTGTCG
CACCTGGTGGGTGTCGTCCCGCTCTGGAGCTACCTCGCGGGGTTCGTCGTGGCCGCAGTG
GCCACCGCGCTGCTGTTGCCCCGGCGAACGGCGGAAATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000109 Oligopeptide transporter (Family)
 [101-451]  2.50000000000001e-36 PF00854
PF00854   PTR2
IPR005279 Amino acid/peptide transporter family (Family)
 [28-465]  8.49999999999995e-106 TIGR00924
TIGR00924   YjdL_sub1_fam
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [4-237]  7.10001443313147e-25 SSF103473 [237-491]  6.00000361638163e-10 SSF103473
SSF103473   MFS_gen_substrate_transporter
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [42-60]  Transmembrane (i-o) [70-92]  Transmembrane (o-i) [97-119]  Transmembrane (i-o) [124-143]  Transmembrane (o-i) [163-185]  Transmembrane (i-o) [190-212]  Transmembrane (o-i) [239-258]  Transmembrane (i-o) [262-279]  Transmembrane (o-i) [302-324]  Transmembrane (i-o) [339-361]  Transmembrane (o-i) [374-396]  Transmembrane (i-o) [406-428]  Transmembrane (o-i) [441-460]  Transmembrane (i-o) [465-487]  Transmembrane (o-i)
Transmembrane 14