close all open/close all

CDS information : Fred_00060


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction7,420 / 7,740 / + [in whole cluster]
7,420 / 7,740 / + [in contig]
Location7420..7740 [in whole cluster]
7420..7740 [in contig]
TypeCDS
Length321 bp (106 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)putative polyketide cyclase
GenefdmD
Gene (GenBank)
EC number
Keyword
  • pentangular
Note
Note (GenBank)
  • FdmD
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
Related Reference
ACC
P39890
PmId
[8218177] Tetracenomycin F2 cyclase: intramolecular aldol condensation in the biosynthesis of tetracenomycin C in Streptomyces glaucescens. (Biochemistry. , 1993)

close this sectionSequence

selected fasta
>putative cyclase [putative polyketide cyclase]
MAHRTLIVARMDHDDADKVAALFAESDATELPHMIGVQRRTLFRFQGLYFHLVEAEAPIN
GDLYQARSHPLYQDINTRLQEFMTPYSPSWREPKDSMAEPFYSWTP
selected fasta
>putative cyclase [putative polyketide cyclase]
ATGGCGCACCGCACCCTCATCGTCGCGCGGATGGACCACGACGACGCCGACAAGGTGGCC
GCGCTCTTCGCCGAGTCCGACGCGACCGAGCTGCCGCACATGATCGGCGTCCAGCGGCGC
ACCCTGTTCCGCTTCCAGGGGCTGTACTTCCACCTCGTCGAGGCCGAGGCGCCCATCAAC
GGCGACCTCTACCAGGCCCGTAGCCACCCGCTCTACCAGGACATCAACACCCGGCTCCAG
GAGTTCATGACCCCGTACTCCCCGTCGTGGCGGGAGCCGAAGGACTCCATGGCCGAGCCC
TTCTACTCCTGGACGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006765 Polyketide synthesis cyclase (Family)
 [3-104]  PD012644
PD012644   Polyketide_synth_cyclase
 [3-105]  1.09999999999999e-47 G3DSA:3.30.70.1090
G3DSA:3.30.70.1090   Cyclase_polyket
 [11-105]  2.1e-40 PF04673
PF04673   Cyclase_polyket
IPR011008 Dimeric alpha-beta barrel (Domain)
 [2-106]  2.80000504261099e-44 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit