close all open/close all

CDS information : Fred_00070


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction7,804 / 8,229 / + [in whole cluster]
7,804 / 8,229 / + [in contig]
Location7804..8229 [in whole cluster]
7804..8229 [in contig]
TypeCDS
Length426 bp (141 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)putative polyketide cyclase
GenefdmE
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • FdmE
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
Related Reference
ACC
P23157
PmId
[15701630] A novel quinone-forming monooxygenase family involved in modification of aromatic polyketides. (J Biol Chem. , 2005)
ACC
P16558
PmId
[8244926] The tcmVI region of the tetracenomycin C biosynthetic gene cluster of Streptomyces glaucescens encodes the tetracenomycin F1 monooxygenase, tetracenomycin F2 cyclase, and, most likely, a second cyclase. (J Bacteriol. , 1993)
[8248801] Enzymatic synthesis of a bacterial polyketide from acetyl and malonyl coenzyme A. (Science. , 1993)
[9609708] Reconstitution of the iterative type II polyketide synthase for tetracenomycin F2 biosynthesis. (Biochemistry. , 1998)

close this sectionSequence

selected fasta
>putative oxidoreductase [putative polyketide cyclase]
MQTSDLIKVAVDDVEPNRARGGDLRVLLSPKTCGATSGFMGVGALEPGEFVSEHYHPYSE
EFFHAVEGRVLLRVDGRELVLEPGESFMVPIGVRHRIENPGSGTARVAFFLSPLAPRPEL
GHVDCEPLPGEGAPPEVGGAR
selected fasta
>putative oxidoreductase [putative polyketide cyclase]
ATGCAGACCTCAGACCTGATCAAAGTCGCCGTCGACGACGTCGAGCCCAACCGGGCGCGC
GGCGGCGACCTCCGTGTCCTGCTCAGCCCCAAGACCTGCGGAGCCACCTCGGGGTTCATG
GGCGTCGGCGCCCTGGAGCCCGGCGAGTTCGTCTCCGAGCACTACCACCCGTACTCCGAG
GAGTTCTTCCACGCCGTCGAGGGCCGTGTCCTGCTGCGGGTCGACGGCCGCGAACTGGTT
CTGGAGCCCGGCGAGTCCTTCATGGTCCCGATCGGCGTCCGGCACCGGATCGAGAACCCG
GGGTCCGGCACGGCCCGCGTCGCCTTCTTCCTGAGCCCGCTCGCCCCGCGCCCGGAGCTG
GGGCACGTGGACTGCGAGCCGCTGCCCGGCGAGGGCGCTCCGCCCGAGGTGGGGGGCGCG
CGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011051 RmlC-like cupin domain (Domain)
 [1-130]  1.89999859865865e-25 SSF51182
SSF51182   RmlC_like_cupin
IPR013096 Cupin 2, conserved barrel (Domain)
 [44-107]  3.5e-19 PF07883
PF07883   Cupin_2
IPR014710 RmlC-like jelly roll fold (Domain)
 [20-123]  6.90000000000001e-25 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
IPR016672 Polyketide biosynthesis protein CurC, predicted (Family)
 [1-139]  3.49999466863949e-61 PIRSF016602
PIRSF016602   CurC_prd
SignalP
 [1-34]  0.086 Signal
Bacteria, Gram-negative   
 [1-38]  0.055 Signal
Eukaryota   
TMHMM No significant hit