close all open/close all

CDS information : Fred_00080


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction8,226 / 9,491 / + [in whole cluster]
8,226 / 9,491 / + [in contig]
Location8226..9491 [in whole cluster]
8226..9491 [in contig]
TypeCDS
Length1,266 bp (421 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)3-ketoacyl-ACP synthase
GenefdmF
Gene (GenBank)
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • FdmF
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
[21867917] Analysis of the ketosynthase-chain length factor heterodimer from the fredericamycin polyketide synthase. (Chem Biol. , 2011)

close this sectionPKS/NRPS Module

KS4..375

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [3-ketoacyl-ACP synthase]
MTARAVITGIGVVAPGRPGRENFWEMIVKGQTATRRITLFDPAPFRSRIGAECDFDPERN
GLSYQEMARTDRAGQFAIVAAREAVADSGMDLGAENAHRVGVSVGNGVGNAISMEQAYRT
VSDNGRRWLVDQEYAGPHLYSSVMSSSLAAEVAWATGAEGPATVVSSGCCAGIDAVGYAV
DLIREGSAEVMVAGATDAPIYPITVSCFDTLRASSTSNDDPEHACRPFDRRRNGLVLGEG
SAVFVVEELEHARRRGARIYCEVAGYSARANGYHMTGLRPDGREMGEAITAALDEARINP
DEVDYANAHGSGTKQNDRHETAAYKRSLGEHAYRIPVSSIKSMVGHSLGSIGSIEIAASA
LAIDRGTVPPTANYEERDPECDLDYVPGTAREAELDVVLSVGSGFGGFQSAVVLTSPRRI
A
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [3-ketoacyl-ACP synthase]
ATGACCGCACGTGCGGTGATCACCGGCATCGGCGTCGTCGCGCCGGGCCGGCCGGGGCGG
GAGAACTTCTGGGAGATGATCGTGAAGGGCCAAACGGCCACACGGCGCATCACCCTCTTC
GATCCGGCGCCTTTCCGCAGCCGCATAGGTGCCGAGTGCGACTTCGACCCCGAGCGCAAC
GGCCTGTCGTACCAGGAGATGGCCCGCACCGACCGGGCGGGCCAGTTCGCGATCGTCGCC
GCCCGGGAGGCGGTCGCGGACAGCGGCATGGACCTCGGCGCCGAGAACGCGCATCGGGTG
GGGGTCAGCGTCGGCAACGGCGTCGGGAACGCCATCTCCATGGAGCAGGCGTACCGGACC
GTCAGCGACAACGGCCGCCGGTGGCTGGTCGACCAGGAGTACGCGGGGCCGCACCTCTAC
TCGTCCGTGATGTCCAGCTCGCTGGCGGCCGAGGTGGCGTGGGCGACCGGCGCGGAGGGC
CCGGCGACGGTGGTCAGCTCGGGCTGCTGCGCGGGCATCGATGCGGTCGGGTACGCCGTC
GACCTGATCCGTGAGGGGTCGGCAGAGGTCATGGTGGCGGGCGCCACGGACGCGCCCATC
TACCCGATCACCGTCTCCTGCTTCGACACCCTGCGGGCCTCCTCCACCAGCAACGACGAC
CCCGAGCACGCCTGCCGTCCGTTCGACAGGCGGCGCAACGGCCTGGTGCTCGGCGAAGGC
TCCGCCGTCTTCGTCGTCGAGGAGCTGGAGCACGCCCGGCGGCGCGGCGCCCGGATCTAC
TGCGAGGTGGCGGGCTACTCGGCCCGCGCCAACGGTTACCACATGACCGGACTGCGGCCG
GACGGGCGGGAGATGGGCGAGGCGATCACCGCCGCGCTCGACGAGGCCCGGATCAACCCG
GACGAGGTCGACTACGCCAACGCGCACGGCTCCGGCACCAAGCAGAACGACCGCCATGAG
ACCGCGGCGTACAAGCGCAGTCTGGGCGAGCACGCCTACCGGATTCCGGTCAGCTCCATC
AAGTCCATGGTCGGTCACTCACTCGGCTCGATCGGCTCCATCGAGATCGCGGCCAGCGCG
CTGGCCATCGACCGCGGGACCGTACCGCCGACCGCCAACTACGAGGAGCGCGACCCCGAG
TGCGACCTCGACTACGTGCCGGGCACGGCGCGCGAGGCGGAGCTCGACGTGGTGCTCAGC
GTGGGCAGCGGCTTCGGCGGGTTCCAGAGCGCGGTGGTGCTCACCTCACCGAGGAGGATC
GCATGA
KS4..375
KS10..1125

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [4-252]  3.2e-53 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [260-375]  1.2e-35 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [3-265]  2.70000000000002e-61 G3DSA:3.40.47.10 [270-416]  1.09999999999999e-50 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-419]  4.30000170645869e-67 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit