close all open/close all

CDS information : Fred_00090


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction9,488 / 10,699 / + [in whole cluster]
9,488 / 10,699 / + [in contig]
Location9488..10699 [in whole cluster]
9488..10699 [in contig]
TypeCDS
Length1,212 bp (403 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)chain length factor
GenefdmG
Gene (GenBank)
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • FdmG
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
[21867917] Analysis of the ketosynthase-chain length factor heterodimer from the fredericamycin polyketide synthase. (Chem Biol. , 2011)

close this sectionPKS/NRPS Module

CLF5..361

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [chain length factor]
MTGPVITGVGVVAPNGLDREAWWQATLDGKSGLGRISRFDPSPYPAQVAGEATGFVPADH
APRRLVSETDAMTQYAFAATNEALADAGVDPAALNDLDMAVITANSSGGVEFGQRELEKL
YAEGPQAVGAYMSIAWFYAATTGQLSIRHGMRGPCGVLCSEQAGGLDVLAQARRVLAKGT
RLVVSGGTDASLSPYGLVCQLANGRLSDESRPERAYLPFDPRARGYVPGEGGAILTVESL
DDARARGAGRIYGQVAGYAATFDPRPGSGRPPGLRRAAELALADAGTGPEGVDVVFADGA
GLPEPDRQEAEALTGLFGRGGVPVSVPKTMTGRLYAGGAPLDVAAAVLALRDQVVPPSVN
VRPDPVHGLDLVTDRPREARLRTALVLARGYGGFNAAVVLRSV
selected fasta
>polyketide synthase chain length factor subunit [chain length factor]
ATGACCGGGCCCGTCATCACCGGGGTGGGCGTCGTGGCGCCCAACGGGCTGGACCGTGAG
GCATGGTGGCAGGCCACGCTGGACGGGAAGTCGGGGCTCGGCCGGATCAGCCGGTTCGAC
CCGTCGCCCTACCCCGCGCAGGTCGCCGGGGAGGCCACCGGGTTCGTCCCGGCCGATCAC
GCGCCGCGCCGGCTGGTCAGCGAGACCGACGCCATGACGCAGTACGCGTTCGCCGCCACC
AACGAGGCCCTCGCCGACGCCGGGGTGGACCCGGCCGCGCTGAACGACCTGGACATGGCG
GTCATCACCGCCAACTCCTCGGGCGGCGTGGAGTTCGGCCAGCGCGAACTGGAGAAGCTC
TACGCCGAGGGACCGCAGGCCGTCGGCGCCTACATGTCCATCGCCTGGTTCTACGCGGCC
ACCACCGGACAGCTCTCGATCCGGCACGGCATGCGCGGCCCCTGCGGCGTCCTCTGCTCC
GAACAGGCCGGCGGCCTGGACGTGCTCGCGCAGGCCCGCCGGGTCCTGGCGAAGGGCACC
CGGCTGGTGGTCTCCGGCGGCACCGACGCCTCGCTCTCCCCCTACGGACTGGTCTGCCAG
CTCGCCAACGGACGGCTCAGCGACGAGTCCCGGCCGGAGCGCGCGTACCTGCCCTTCGAC
CCGCGGGCACGCGGCTACGTGCCAGGGGAGGGAGGTGCGATCCTCACCGTCGAGAGCCTC
GACGATGCGCGGGCCCGCGGCGCCGGCCGGATCTACGGCCAGGTCGCCGGGTACGCGGCC
ACCTTCGATCCCCGTCCGGGCTCAGGGCGGCCACCGGGACTGCGGCGCGCCGCCGAACTG
GCCCTCGCCGACGCGGGGACCGGGCCGGAGGGCGTGGACGTGGTCTTCGCCGACGGCGCC
GGCCTGCCGGAGCCGGACCGTCAGGAGGCCGAGGCCCTCACCGGGCTGTTCGGGCGAGGC
GGTGTGCCGGTCTCCGTCCCCAAGACGATGACCGGCCGGCTCTACGCGGGCGGCGCACCC
CTCGACGTCGCGGCGGCGGTGCTCGCCCTGCGGGACCAGGTCGTCCCGCCCTCGGTCAAC
GTCCGTCCCGACCCCGTCCACGGCCTCGACCTGGTCACCGACCGGCCGCGTGAGGCCCGC
CTGCGGACCGCCCTGGTCCTCGCCCGTGGCTACGGAGGCTTCAACGCCGCCGTGGTCCTC
AGATCCGTCTGA
CLF5..361
CLF13..1083

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [5-242]  2.1e-45 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [252-361]  4.80000000000001e-25 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [5-257]  1.40000000000001e-48 G3DSA:3.40.47.10 [269-402]  7.29999999999998e-37 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-248]  2.39999798157265e-55 SSF53901 [211-403]  3.39999972437719e-48 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit