close all open/close all

CDS information : Fred_00100


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction10,764 / 11,018 / + [in whole cluster]
10,764 / 11,018 / + [in contig]
Location10764..11018 [in whole cluster]
10764..11018 [in contig]
TypeCDS
Length255 bp (84 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)ACP
GenefdmH
Gene (GenBank)
EC number
Keyword
  • type II PKS
  • hexadienyl unit
Note
Note (GenBank)
  • FdmH
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
[16895912] A dedicated phosphopantetheinyl transferase for the fredericamycin polyketide synthase from Streptomyces griseus. (J Biol Chem. , 2006)
[20540492] Mechanism and engineering of polyketide chain initiation in fredericamycin biosynthesis. (J Am Chem Soc. , 2010)
[21867917] Analysis of the ketosynthase-chain length factor heterodimer from the fredericamycin polyketide synthase. (Chem Biol. , 2011)

close this sectionPKS/NRPS Module

ACP5..78

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [ACP]
MSTISFNDLKTIMSRSLGEVDGTELTEADLTTPFTEIGYDSLAVLEIASQLQREYGLQIP
DEAIEEMDTPQAVIDYVNTSLAGV
selected fasta
>polyketide synthase acyl carrier protein subunit [ACP]
ATGAGCACCATCAGCTTCAACGACCTCAAGACCATCATGAGCCGCAGTCTCGGCGAGGTG
GACGGGACCGAACTCACCGAGGCCGACCTGACCACCCCCTTCACCGAGATCGGCTACGAC
TCGCTCGCCGTCCTGGAGATCGCCAGCCAGCTCCAGCGGGAGTACGGCCTCCAGATACCG
GACGAGGCCATCGAGGAGATGGACACGCCGCAGGCCGTCATCGACTACGTCAACACCAGC
CTGGCGGGGGTCTGA
ACP5..78
ACP13..234

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003231 Acyl carrier protein (ACP) (Family)
 [40-79]  PD000887
PD000887   PD000887
IPR006162 Phosphopantetheine attachment site (PTM)
 [36-51]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [5-78]  PS50075
PS50075   ACP_DOMAIN
 [8-77]  1.9e-13 PF00550
PF00550   PP-binding
 [2-83]  3.1999989904635e-16 SSF47336
SSF47336   ACP_like
 [13-81]  3.60000000000001e-18 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
SignalP
 [1-18]  0.063 Signal
Eukaryota   
TMHMM No significant hit