close all open/close all

CDS information : Fred_00120


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction11,484 / 11,807 / + [in whole cluster]
11,484 / 11,807 / + [in contig]
Location11484..11807 [in whole cluster]
11484..11807 [in contig]
TypeCDS
Length324 bp (107 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative monooxygenase
GenefdmJ
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • FdmJ
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [putative monooxygenase]
MRPGLRVLLRIRVAEGQEERFEELWRAHAETVRSFTDNHGQQLLRTRGERGSYTVLTDWT
DEPSFRAFERSPEQQAYLRELWAIRSGGEMQLLDLVHTLSPATPAEA
selected fasta
>hypothetical protein [putative monooxygenase]
GTGAGGCCCGGACTGCGGGTGCTGTTGCGCATACGCGTCGCCGAGGGCCAGGAGGAACGG
TTCGAGGAGCTGTGGCGCGCCCACGCCGAGACCGTCCGTAGCTTCACCGACAACCATGGT
CAGCAACTGCTGCGTACGCGTGGCGAGCGCGGCAGCTACACCGTGCTGACGGACTGGACG
GACGAGCCGTCCTTCCGGGCCTTCGAGCGCAGCCCCGAGCAGCAGGCGTACCTGCGCGAG
CTCTGGGCTATCCGCAGCGGCGGCGAGATGCAGCTGCTCGACCTCGTTCACACCCTCTCA
CCGGCCACCCCGGCCGAAGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [6-79]  3.60000000000001e-15 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-103]  1.20000117458134e-14 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP
 [1-16]  0.257 Signal
Eukaryota   
TMHMM No significant hit