close all open/close all

CDS information : Fred_00130


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction11,825 / 12,259 / + [in whole cluster]
11,825 / 12,259 / + [in contig]
Location11825..12259 [in whole cluster]
11825..12259 [in contig]
TypeCDS
Length435 bp (144 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative oxygenase
GenefdmK
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • FdmK
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [putative oxygenase]
MSVQQEQVTELIDLVQSVPAKEVEGVVATRPGGVDGALTLIFDLLVSEFNPAKAEGEKGV
FQFDIACADGRKHHHVEVVDGTCRTGQGVHDHPDITIGIKFPDMLAMGVGKLPGAKAFLT
GKLKLRGSPLMGTKLGEWFDHPET
selected fasta
>hypothetical protein [putative oxygenase]
ATGAGTGTGCAGCAGGAACAGGTGACCGAACTGATCGACCTGGTCCAGTCGGTGCCGGCC
AAGGAGGTCGAGGGGGTGGTCGCGACCCGCCCCGGTGGTGTCGACGGCGCCCTGACCCTC
ATCTTCGATCTGCTGGTGTCGGAGTTCAACCCGGCCAAGGCCGAGGGCGAGAAGGGGGTG
TTCCAGTTCGACATCGCCTGCGCCGACGGCAGGAAGCACCACCACGTGGAGGTCGTGGAC
GGCACCTGCCGGACCGGTCAGGGAGTGCACGACCACCCCGACATCACCATCGGCATCAAG
TTCCCGGACATGCTGGCGATGGGGGTGGGCAAGCTCCCCGGCGCGAAGGCGTTCCTGACC
GGCAAGCTGAAGCTCCGTGGCAGCCCGCTGATGGGCACGAAGCTGGGTGAGTGGTTCGAC
CACCCCGAGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003033 SCP2 sterol-binding domain (Domain)
 [55-137]  1.2e-09 PF02036
PF02036   SCP2
 [26-140]  5.8999880940569e-18 SSF55718
SSF55718   SCP2
SignalP
 [1-28]  0.052 Signal
Eukaryota   
TMHMM No significant hit