close all open/close all

CDS information : Fred_00140


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction13,073 / 12,333 / - [in whole cluster]
13,073 / 12,333 / - [in contig]
Locationcomplement(12333..13073) [in whole cluster]
complement(12333..13073) [in contig]
TypeCDS
Length741 bp (246 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative monooxygenase
GenefdmL
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • FdmL
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [putative monooxygenase]
MPLDAVTYRVAPGHEEELTEVFSPHNFTRVDSPVIKNGTGETVGMLLGTGLFVQEDVMVR
VIHHDGVGAARIAHHMSVQKGVHDAERAILPYLAEPRDTETPEGFREHFHRSLMTVLEQH
SPDERPAAGTVALRYPLRAGAGAELAAARATANVRAFLRLAEEYPAIVRTALFLHEDTLV
RVVQYDGHPYDVVSYLADRCFGQDAESWLVPYLRAPERHPDRDAYLARVHEQAMFSLAHM
SVLGVG
selected fasta
>hypothetical protein [putative monooxygenase]
ATGCCGCTGGACGCCGTCACCTACCGCGTCGCTCCCGGCCACGAGGAGGAACTCACCGAG
GTCTTCTCACCCCACAACTTCACCCGGGTCGACTCCCCGGTGATCAAGAACGGCACAGGT
GAGACGGTCGGGATGCTCCTCGGCACGGGCCTGTTCGTCCAGGAGGACGTGATGGTCCGG
GTGATCCACCACGACGGCGTCGGCGCTGCGAGGATCGCCCACCACATGTCGGTCCAGAAG
GGCGTGCACGACGCGGAGCGGGCCATCCTGCCCTACCTCGCCGAACCCCGTGACACCGAG
ACCCCCGAGGGGTTCCGGGAGCACTTCCACCGCAGCCTGATGACGGTCCTGGAACAGCAC
AGTCCCGACGAACGCCCCGCCGCGGGGACGGTCGCCCTGCGCTACCCGCTGCGGGCGGGG
GCCGGCGCGGAGCTGGCGGCCGCCCGGGCCACGGCCAACGTACGGGCCTTCCTGCGGCTG
GCCGAGGAGTATCCGGCCATCGTCCGCACGGCACTGTTCCTGCACGAGGACACGCTGGTG
CGGGTCGTGCAGTACGACGGTCACCCCTACGACGTGGTGTCCTACCTCGCGGACCGCTGC
TTCGGGCAGGACGCGGAGTCGTGGCTCGTGCCCTACCTCCGGGCCCCGGAGCGGCACCCG
GACCGGGACGCCTATCTGGCGCGCGTCCATGAGCAGGCGATGTTCTCCCTCGCCCACATG
TCCGTGCTCGGCGTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007575 SchA/CurD-like domain (Domain)
 [1-123]  4.10000000000004e-41 PF04486 [131-242]  2.1e-28 PF04486
PF04486   SchA_CurD
SignalP No significant hit
TMHMM No significant hit