close all open/close all

CDS information : Fred_00150


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction13,560 / 13,111 / - [in whole cluster]
13,560 / 13,111 / - [in contig]
Locationcomplement(13111..13560) [in whole cluster]
complement(13111..13560) [in contig]
TypeCDS
Length450 bp (149 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Producthydroxylase
Product (GenBank)putative monooxygenase
GenefdmM
Gene (GenBank)
EC number
Keyword
  • pentangular C-14
Note
Note (GenBank)
  • FdmM
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
[19620242] In vivo investigation of the roles of FdmM and FdmM1 in fredericamycin biosynthesis unveiling a new family of oxygenases. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>hydroxylase [putative monooxygenase]
MMLEEVLSGVVLAGTGTVTGVFVAVAVSVGPAMSAMGRAEYLRAHALLGKGYHPLMPILV
NIVTLSGFALAFLAGAPGNVLFPLASVLLIGVQAVSHLGNVPINRSLSGLAAAGSWVDPR
PQWRAWHRLRTVLAALALAAVTVAVLTAR
selected fasta
>hydroxylase [putative monooxygenase]
GTGATGCTCGAGGAAGTGCTGAGCGGAGTCGTGCTGGCCGGGACGGGGACCGTCACGGGG
GTCTTCGTCGCCGTCGCCGTCAGCGTCGGTCCCGCCATGTCGGCGATGGGACGCGCCGAA
TACCTGCGGGCACACGCGCTGCTCGGCAAGGGGTACCACCCGCTGATGCCGATCCTGGTC
AACATCGTGACGCTGAGCGGGTTCGCCCTCGCGTTCCTCGCCGGGGCACCGGGGAATGTC
CTGTTCCCCCTCGCCTCGGTGCTGCTCATCGGCGTGCAGGCGGTCTCACACCTCGGCAAC
GTCCCGATCAACCGCTCGCTGAGCGGCCTCGCGGCCGCGGGGTCCTGGGTGGACCCCCGT
CCGCAGTGGCGCGCCTGGCACCGCCTGCGGACGGTCCTGGCGGCACTCGCCCTGGCCGCC
GTCACGGTCGCGGTGCTCACCGCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013901 Protein of unknown function DUF1772 (Family)
 [20-144]  1.3e-19 PF08592
PF08592   DUF1772
SignalP
 [1-26]  0.505 Signal
Bacteria, Gram-negative   
 [1-34]  0.843 Signal
Bacteria, Gram-positive   
 [1-34]  0.5 Signal
Eukaryota   
TMHMM
 [7-29]  Transmembrane (i-o) [51-73]  Transmembrane (o-i) [80-99]  Transmembrane (i-o) [126-148]  Transmembrane (o-i)
Transmembrane 4