close all open/close all

CDS information : Fred_00160


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction13,801 / 14,265 / + [in whole cluster]
13,801 / 14,265 / + [in contig]
Location13801..14265 [in whole cluster]
13801..14265 [in contig]
TypeCDS
Length465 bp (154 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Producthydroxylase
Product (GenBank)putative monooxygenase
GenefdmM1
Gene (GenBank)
EC number
Keyword
  • pentangular C-13
Note
Note (GenBank)
  • FdmM1
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
[19620242] In vivo investigation of the roles of FdmM and FdmM1 in fredericamycin biosynthesis unveiling a new family of oxygenases. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>hydroxylase [putative monooxygenase]
MAWEQVLMPPALLAGGLAAGGLAISVLAAPLFTTLPTVMYVPVHQGLVTRFDPFMPVSLA
SCLFCDAALVLAAQGGAVRLLAAAAALLLACAMTVSLTKNVPINRWLATLDPRALPADFQ
RRDPRTRWIRWNRVRGALAVAALVANVAAAALLI
selected fasta
>hydroxylase [putative monooxygenase]
GTGGCCTGGGAACAGGTACTCATGCCGCCGGCGCTGCTCGCCGGCGGGCTCGCGGCCGGT
GGCCTGGCGATCTCGGTGCTGGCCGCGCCGTTGTTCACCACCCTCCCGACCGTGATGTAC
GTCCCGGTCCACCAGGGCCTGGTCACCCGCTTCGATCCGTTCATGCCCGTGTCGCTGGCG
AGCTGCCTGTTCTGCGACGCCGCCCTGGTCCTTGCGGCCCAGGGCGGGGCGGTCCGGCTG
CTGGCCGCGGCGGCGGCGCTGCTGCTGGCCTGCGCCATGACGGTGTCGCTCACCAAGAAC
GTGCCGATCAACCGGTGGCTGGCGACCCTCGACCCGCGGGCGCTCCCCGCCGACTTCCAG
CGACGCGACCCCCGCACACGGTGGATCCGCTGGAACCGCGTACGGGGCGCTCTCGCGGTG
GCGGCGCTGGTGGCCAACGTCGCGGCGGCCGCGCTTCTCATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013901 Protein of unknown function DUF1772 (Family)
 [22-149]  1.7e-16 PF08592
PF08592   DUF1772
SignalP
 [1-28]  0.992 Signal
Bacteria, Gram-negative   
 [1-28]  0.984 Signal
Bacteria, Gram-positive   
 [1-28]  0.977 Signal
Eukaryota   
TMHMM
 [12-34]  Transmembrane (i-o) [75-97]  Transmembrane (o-i) [131-153]  Transmembrane (i-o)
Transmembrane 3