close all open/close all

CDS information : Fred_00170


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction14,322 / 15,383 / + [in whole cluster]
14,322 / 15,383 / + [in contig]
Location14322..15383 [in whole cluster]
14322..15383 [in contig]
TypeCDS
Length1,062 bp (353 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)putative o-methyltransferase
GenefdmN
Gene (GenBank)
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • FdmN
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
Related Reference
ACC
P16559
PmId
[1548230] Nucleotide sequence of the tcmII-tcmIV region of the tetracenomycin C biosynthetic gene cluster of Streptomyces glaucescens and evidence that the tcmN gene encodes a multifunctional cyclase-dehydratase-O-methyl transferase. (J Bacteriol. , 1992)
ACC
Q7X2G8
NITE
Gilvo_00100
PmId
[22800463] Roles of the Synergistic Reductive O-Methyltransferase GilM and of O-Methyltransferase GilMT in the Gilvocarcin Biosynthetic Pathway. (J Am Chem Soc. , 2012)

close this sectionSequence

selected fasta
>putative O-methyltransferase [putative o-methyltransferase]
MDTMTGVVGPALTASLPPHVRLLLLTDGKRISRVLHVLAELAVADELADGPLTVAELAVR
TDAHPDSLGRVLRVAAAFGVFEEREDGRYALTELSEVLRSDVPGSQRDMVLYNGTEMLWR
SYGSLLHTVRTGRPAFEAVYQQDFFTHLEENPQAGALFDRAMTGMSRATARMLLDSYDFG
RFLRLADVGGGRGLFLAEVLTRHPGSRGTLIDRPAVTGEAAGLLREAGVADRVEVVPGDF
FEELPKGHDAYVLKAVLHDWDDRRAAAILGRVRDALAGRPDGRLLICEFLVGPANQWDRG
KLLDLDMLVRFGGRERDADQWRALLAATGFELVNDPVPGRWAVLECRPVPADG
selected fasta
>putative O-methyltransferase [putative o-methyltransferase]
GTGGACACCATGACCGGTGTGGTCGGGCCGGCGTTGACCGCCTCGTTGCCGCCCCACGTA
CGCCTGTTGCTGCTGACGGACGGCAAACGGATATCCCGGGTGCTGCACGTCCTGGCCGAA
CTGGCCGTCGCCGACGAGCTGGCGGACGGACCGCTGACCGTCGCCGAGCTCGCCGTACGT
ACCGACGCCCACCCGGACTCCCTGGGGCGCGTGTTGCGGGTCGCCGCCGCGTTCGGCGTC
TTCGAGGAGCGGGAGGACGGCCGGTACGCGCTGACCGAGCTCAGCGAGGTGCTCCGCTCC
GACGTGCCCGGCAGCCAGCGGGACATGGTGCTCTACAACGGCACCGAGATGCTGTGGCGC
TCCTACGGCTCCCTCCTGCACACGGTGCGGACCGGCCGGCCCGCCTTCGAGGCGGTCTAC
CAGCAGGACTTCTTCACACACCTGGAGGAGAACCCGCAGGCGGGAGCCCTCTTCGACCGG
GCGATGACCGGGATGAGCCGGGCCACCGCGCGGATGCTCCTCGACAGTTACGACTTCGGG
CGGTTCCTCCGCCTCGCGGACGTGGGAGGTGGCCGCGGACTCTTCCTCGCCGAAGTGCTC
ACCCGTCATCCCGGAAGCCGGGGAACGCTGATCGACCGGCCGGCGGTGACCGGGGAGGCG
GCCGGGCTGCTCCGCGAGGCCGGGGTCGCCGACCGGGTCGAGGTGGTGCCCGGCGACTTC
TTCGAGGAGCTGCCGAAGGGCCATGACGCCTATGTGCTCAAGGCCGTGCTGCACGACTGG
GACGACCGGCGCGCGGCCGCCATCCTCGGCCGGGTCCGTGACGCGCTGGCGGGCCGCCCG
GACGGCCGGCTGCTGATCTGCGAGTTCCTCGTCGGCCCCGCCAACCAGTGGGACCGCGGC
AAATTGCTCGACCTGGACATGCTGGTCCGCTTCGGCGGCCGTGAGCGCGACGCGGACCAG
TGGAGGGCGCTGCTGGCGGCCACCGGCTTCGAGCTGGTGAACGACCCGGTGCCCGGGCGC
TGGGCGGTCCTGGAGTGCCGCCCGGTACCGGCCGACGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [86-325]  1e-62 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [22-95]  8.59999999999999e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-348]  1.09999909120787e-14 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit