close all open/close all

CDS information : Fred_00180


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction15,497 / 16,246 / + [in whole cluster]
15,497 / 16,246 / + [in contig]
Location15497..16246 [in whole cluster]
15497..16246 [in contig]
TypeCDS
Length750 bp (249 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative ketoreductase
Product (GenBank)putative 3-ketoacyl-ACP reductase
GenefdmO
Gene (GenBank)
EC number
Keyword
  • pentangular
Note
Note (GenBank)
  • FdmO
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
[20540492] Mechanism and engineering of polyketide chain initiation in fredericamycin biosynthesis. (J Am Chem Soc. , 2010)
Related Reference
ACC
B1GSM5
NITE
Bena_00150
PmId
[17625850] Biosynthesis of pentangular polyphenols: deductions from the benastatin and griseorhodin pathways. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>putative ketoreductase [putative 3-ketoacyl-ACP reductase]
MELRLVGTNALVTGGTRGIGRAIVLALAKAGATVVTCYRTEGEAADSLARELKELGGDHA
LVRADVGTTEGVEAVLAACRTRFETLDVLVNNAGIISQVPFAQLPFEEWERVVTTNLTGP
FMVISKALPLLRKGSSVINIGSRGAMAGIPLRGHYTASKAGLVGLTRSLCKELGGKGIRF
NVVAPGVIDTSEPEELTEEQRAAYDERYLRMMALGRFGRPDEIAGAVLFLASDLSTYVNG
ETLHVDGGV
selected fasta
>putative ketoreductase [putative 3-ketoacyl-ACP reductase]
ATGGAACTTCGACTGGTAGGCACGAACGCGCTGGTCACCGGCGGTACCCGGGGTATCGGC
CGGGCCATCGTGCTGGCCCTGGCCAAGGCCGGTGCCACCGTGGTGACCTGCTACCGCACC
GAGGGCGAGGCCGCCGACAGCCTGGCCCGCGAACTGAAGGAGCTGGGGGGTGACCACGCC
CTGGTCCGCGCGGACGTCGGCACGACCGAGGGCGTGGAGGCGGTGCTGGCCGCGTGCCGC
ACGCGTTTCGAGACGCTGGACGTCCTGGTCAACAACGCCGGGATCATCAGCCAGGTGCCC
TTCGCCCAGCTGCCCTTCGAGGAGTGGGAGCGGGTCGTCACGACCAACCTGACCGGCCCC
TTCATGGTGATCAGCAAGGCGCTGCCGCTGCTGCGGAAGGGGTCCTCGGTGATCAACATC
GGTTCGCGCGGCGCCATGGCGGGCATTCCGCTGCGTGGCCACTACACCGCCTCCAAGGCG
GGCCTGGTCGGGCTGACCAGAAGCCTGTGCAAGGAACTGGGCGGCAAGGGCATCCGGTTC
AACGTGGTGGCACCGGGCGTCATCGACACCTCGGAGCCGGAGGAGCTGACGGAGGAGCAG
CGGGCCGCGTACGACGAGCGCTACCTGCGGATGATGGCGCTGGGCCGCTTCGGGCGCCCC
GACGAGATCGCCGGCGCGGTCCTCTTCCTCGCCAGCGACCTGTCCACCTACGTCAATGGC
GAGACCCTGCATGTCGACGGGGGTGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [84-95]  4.19999771339581e-12 PR00080 [135-143]  4.19999771339581e-12 PR00080 [155-174]  4.19999771339581e-12 PR00080
PR00080   SDRFAMILY
 [10-173]  2.89999999999999e-36 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [9-26]  5.50001754266469e-41 PR00081 [84-95]  5.50001754266469e-41 PR00081 [129-145]  5.50001754266469e-41 PR00081 [155-174]  5.50001754266469e-41 PR00081 [176-193]  5.50001754266469e-41 PR00081 [213-233]  5.50001754266469e-41 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [2-248]  2.59999999999995e-84 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [142-170]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit