close all open/close all

CDS information : Fred_00210


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction18,041 / 17,040 / - [in whole cluster]
18,041 / 17,040 / - [in contig]
Locationcomplement(17040..18041) [in whole cluster]
complement(17040..18041) [in contig]
TypeCDS
Length1,002 bp (333 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productbeta-ketoacyl synthase
Product (GenBank)putative 3-keto-acyl-ACP synthase
GenefdmS
Gene (GenBank)
EC number
Keyword
  • hexadienyl unit
Note
Note (GenBank)
  • FdmS
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)
[20540492] Mechanism and engineering of polyketide chain initiation in fredericamycin biosynthesis. (J Am Chem Soc. , 2010)
Related Reference
ACC
Q9F6D4
NITE
R1128_00080
PmId
[11732905] In vitro reconstitution and analysis of the chain initiating enzymes of the R1128 polyketide synthase. (Biochemistry. , 2001)
[12767243] Ketosynthases in the initiation and elongation modules of aromatic polyketide synthases have orthogonal acyl carrier protein specificity. (Biochemistry. , 2003)
[19292437] Biosynthesis of aromatic polyketides in bacteria. (Acc Chem Res. , 2009)

close this sectionPKS/NRPS Module

KS11..332

close this sectionSequence

selected fasta
>beta-ketoacyl synthase [putative 3-keto-acyl-ACP synthase]
MTAIRDTEVLRHSRLLGVGVHRPERSVPNTEIAGRTGLDPDWIERRSGIRSRRYAGPEET
LPAMATAAAEKALAAAGVSADRIDTVIVATITSMEQMPAVAVEVARRLGADRAAAFDVSA
ACAGFCHALALAGDQVRMGRADHVLVIGAERMTDILDHEDGDTAFLFADGAGAVVVGPSH
EPGIGPVVWRADGTRNAALRMTAPWHDGTGLRPEARPAITMSGWKVFRWATNELVPAARK
MLDLAGVTVDDLDAFIPHQANMLITDHVVDQLGLPAHTAVARDIVTSGNSSAASIPLAME
ELLAGGKAPSGGLALLIGFGAGLVYAGQVVRLP
selected fasta
>beta-ketoacyl synthase [putative 3-keto-acyl-ACP synthase]
ATGACTGCGATCCGGGACACCGAGGTCCTGCGCCACAGCCGCCTGCTGGGGGTCGGCGTC
CACCGCCCCGAACGGTCCGTCCCCAACACCGAGATCGCCGGGCGGACGGGGCTCGACCCC
GACTGGATCGAGCGCCGGTCGGGCATCCGGTCCCGCCGCTACGCTGGACCGGAGGAGACC
CTGCCCGCCATGGCCACCGCCGCGGCCGAGAAGGCGCTGGCCGCCGCGGGCGTCTCCGCG
GACCGGATCGACACGGTCATCGTCGCCACCATCACCTCCATGGAGCAGATGCCGGCCGTC
GCGGTCGAGGTGGCGCGCCGGCTCGGCGCGGACCGGGCCGCCGCCTTCGACGTCTCGGCC
GCCTGCGCGGGCTTCTGCCACGCCCTGGCGCTCGCCGGCGACCAGGTGCGGATGGGCCGC
GCCGACCACGTGCTGGTCATCGGCGCGGAACGGATGACGGACATCCTCGACCACGAGGAC
GGCGACACCGCCTTCCTCTTCGCCGACGGCGCCGGTGCCGTGGTCGTCGGGCCCTCGCAC
GAGCCCGGGATCGGCCCCGTCGTCTGGCGGGCGGACGGGACGCGCAACGCCGCCCTGCGC
ATGACCGCTCCCTGGCACGACGGTACCGGCCTGCGGCCCGAGGCACGGCCGGCCATCACC
ATGTCGGGCTGGAAGGTCTTCCGCTGGGCCACCAACGAACTGGTGCCCGCCGCGAGGAAG
ATGCTGGACCTGGCCGGTGTGACCGTCGACGACCTCGACGCCTTCATCCCGCACCAGGCC
AACATGCTCATCACCGACCACGTCGTCGACCAGCTCGGCCTGCCCGCACACACCGCCGTG
GCCCGGGACATCGTCACCAGCGGCAACAGCTCCGCCGCCTCGATCCCGCTGGCCATGGAG
GAGCTGCTGGCCGGCGGCAAGGCCCCCAGCGGCGGGCTCGCCCTGCTGATCGGCTTCGGG
GCGGGGCTGGTCTACGCGGGCCAGGTCGTCCGGCTCCCCTGA
KS11..332
KS31..996

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004655 Beta-ketoacyl-acyl carrier protein synthase III (FabH) (Family)
 [12-331]  5.80000000000004e-95 TIGR00747
TIGR00747   FabH
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [242-331]  4.2e-26 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [116-193]  8.00000000000001e-26 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [12-170]  2.29999999999998e-54 G3DSA:3.40.47.10 [171-331]  1.99999999999999e-40 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [10-332]  3.39999972437719e-52 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit