close all open/close all

CDS information : Fred_00220


close this sectionLocation

Organism
StrainATCC 49344
Entry nameFredericamycin
Contig
Start / Stop / Direction19,153 / 18,122 / - [in whole cluster]
19,153 / 18,122 / - [in contig]
Locationcomplement(18122..19153) [in whole cluster]
complement(18122..19153) [in contig]
TypeCDS
Length1,032 bp (343 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative membrane transporter
GenefdmT1
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • FdmT1
Reference
ACC
PmId
[16305230] Cloning, sequencing, analysis, and heterologous expression of the fredericamycin biosynthetic gene cluster from Streptomyces griseus. (J Am Chem Soc. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [putative membrane transporter]
MSTTDQAERPPAPGTRSDHRGPAAGSAPPPGPPGGVRWAYAMVIVATLAAIASNVFEIAD
QIETGVAGAATTGDLVLTIAFCALFGFFAEMLRAGRQWGRVLLTVFTSLGIVFTGLGLAG
LGGRPLVGALQGSLAVISLVTSVVGLVLLFLPSVNRWMSAVRRQSRTVPQRLRKIVLTAH
VAISVGWLGLVTGMFAMSVSGATTGSAEQQAAMYRTMSMLDEIFLGMTSMFALITGIVVG
AGTKWGLLQRRWVAVKFFLTMGVMILGFGVIHQLILRANELVDAGAPVRGGELDTVGWSM
AGSAALAVVSLVFMTAVSTYKPWGPTRWGKKARPGAAASRTDR
selected fasta
>hypothetical protein [putative membrane transporter]
GTGAGTACGACAGACCAGGCGGAGAGGCCGCCCGCACCGGGAACAAGGTCCGACCACCGT
GGGCCCGCCGCCGGGTCGGCGCCGCCCCCTGGACCACCGGGCGGCGTCCGCTGGGCCTAC
GCCATGGTGATCGTGGCCACGCTCGCGGCCATCGCCAGCAACGTCTTCGAGATCGCCGAC
CAGATCGAGACCGGGGTGGCCGGTGCCGCCACGACCGGGGACCTCGTCCTGACCATCGCG
TTCTGCGCGCTGTTCGGATTCTTCGCCGAGATGCTCAGGGCCGGCCGCCAGTGGGGGCGG
GTGCTGCTGACGGTCTTCACCTCGCTGGGCATCGTCTTCACCGGTCTGGGCCTGGCCGGG
CTGGGCGGGCGGCCCCTGGTGGGCGCACTGCAGGGTTCCCTGGCCGTGATCAGCCTCGTG
ACCTCCGTGGTCGGCCTGGTGCTGCTCTTCCTGCCGTCCGTCAACCGTTGGATGAGCGCC
GTGCGCCGGCAGAGCCGCACCGTCCCGCAGCGGCTGCGCAAGATCGTCCTCACCGCCCAC
GTGGCGATCTCGGTGGGCTGGCTGGGGCTGGTGACCGGCATGTTCGCCATGTCGGTCTCG
GGCGCCACCACGGGCAGCGCCGAGCAGCAGGCCGCGATGTACCGCACCATGTCGATGCTA
GACGAGATCTTTCTCGGCATGACCAGCATGTTCGCCCTCATCACCGGCATCGTGGTCGGG
GCGGGGACCAAGTGGGGACTGCTCCAGCGCCGTTGGGTGGCCGTGAAGTTCTTCCTCACC
ATGGGCGTGATGATCCTCGGGTTCGGCGTCATCCACCAGCTCATCCTGCGCGCCAATGAA
CTCGTCGACGCCGGAGCCCCGGTGCGCGGGGGCGAACTCGACACCGTGGGCTGGTCGATG
GCCGGATCGGCCGCCCTGGCCGTGGTCTCCCTGGTGTTCATGACCGCCGTCTCCACGTAC
AAGCCCTGGGGCCCGACCCGCTGGGGGAAGAAGGCGCGCCCGGGCGCTGCCGCGTCCCGG
ACGGACCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [34-56]  Transmembrane (i-o) [66-88]  Transmembrane (o-i) [101-123]  Transmembrane (i-o) [133-155]  Transmembrane (o-i) [175-197]  Transmembrane (i-o) [223-242]  Transmembrane (o-i) [254-276]  Transmembrane (i-o) [296-318]  Transmembrane (o-i)
Transmembrane 8